KEGG   Massilia sp. WG5: AM586_04445Help
Entry
AM586_04445       CDS       T04122                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
masw  Massilia sp. WG5
Brite
KEGG Orthology (KO) [BR:masw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AM586_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4 DUF11
Motif
Other DBs
NCBI-ProteinID: ALK95647
Position
4172924..4173298
Genome map
AA seq 124 aa AA seqDB search
MAVYDFAINVRTQYLPEQSKPERTLHVFTYTITIKNTGDVPAQLISRHWVITDASGKTQE
VRGLGVVGHQPLLKPGEEFEYTSGTQLETAQGSMMGEYFFVAEDGHRFEVTIPEFVLSLP
RALH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttacgatttcgcgatcaatgtcaggacgcaatacctgcccgagcagtccaaa
cccgagcggacattgcacgtgtttacctacacgatcacgatcaagaataccggcgacgtg
ccggcccagctgatctcgcgccactgggtgatcaccgatgccagcggcaagacgcaggaa
gtgcgcggcctgggcgtggttggccaccagccgctgctcaagcccggcgaggaattcgaa
tacaccagcggcacccagctggaaacggcccagggctcgatgatgggcgaatacttcttc
gtggccgaggatggccaccgcttcgaagtgacgatccccgaattcgtgctgtcgctgccg
cgcgccctgcactga

DBGET integrated database retrieval system