KEGG   Massilia sp. WG5: AM586_04745Help
Entry
AM586_04745       CDS       T04122                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
masw  Massilia sp. WG5
Pathway
masw00270  Cysteine and methionine metabolism
masw00480  Glutathione metabolism
masw01100  Metabolic pathways
Module
masw_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AM586_04745
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AM586_04745
Enzymes [BR:masw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AM586_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST Rimk_N ATP-grasp_3 RGCC
Motif
Other DBs
NCBI-ProteinID: ALK95683
Position
4240566..4241513
Genome map
AA seq 315 aa AA seqDB search
MKIAFLADPLSGFKIYKDSTFAMMREAARRGHQIYAFEQRHMVLEQGVVTADVVEITLTG
DPDEWYIAGEASTVRLSEFDAVIQRKDPPFDMEYVYGTYLLELAERQGARVFNKPSAIRD
HNEKLTIAQFSEFTSPTLVSSSATRLRAFHAEHDDVIFKPLDGMGGAGIFRVKDDGLNLG
SIIETLTDNGARTIMAQKYIPAIVKGDKRVLVIDGKPVPFVLARIPQGGEVRGNLAAGGV
GVAQPISAREREIAEALGPKLAERGLLLVGLDVIGDFLTEVNVTSPTCFQEITDQTGFDV
PAMFIDAVERRASNT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcttttctcgccgacccgctgtccggattcaagatctacaaggactcgact
ttcgcgatgatgcgggaggcggcgcgccgcggccaccagatctacgccttcgaacagcgc
cacatggtgctggagcagggcgtggtgactgccgacgtggtcgagatcacgctgaccggc
gatccggacgagtggtacatcgcgggcgaggccagcaccgtgcgcctgtccgagttcgac
gccgtcatccagcgcaaggatccgcccttcgacatggaatacgtgtacggcacctacctg
ctggagctggccgagcgccagggcgcgcgcgtgttcaacaagccttcggcaatccgcgac
cacaacgaaaagctgaccatcgcccagttcagcgagttcacctcgccgaccctggtgtcc
tcctcggcgacgcgcctgcgcgccttccacgccgagcacgacgacgtgatcttcaagccg
ctcgacggcatgggcggcgccggcatcttccgcgtcaaggacgacggcctgaacctcggc
tcgatcatcgagaccctgaccgacaacggcgcgcgcaccatcatggcccagaaatacatc
ccggccatcgtcaagggcgacaagcgggtgctggtcatcgacggcaagccggtgcccttc
gtactggcgcgcatcccgcagggcggcgaagtgcgcggcaacctggcggccggcggcgtc
ggcgtggcccagccgatttccgcgcgcgagcgcgagatcgcggaagccctcggccccaaa
ctggccgagcgtggcctgttgctggtaggattggatgtgatcggcgatttcctgaccgag
gtgaatgtcaccagcccgacctgcttccaggagatcaccgaccagaccggcttcgacgtg
cctgcgatgttcatcgacgcagtcgagcgccgcgcttcgaatacttga

DBGET integrated database retrieval system