KEGG   Massilia sp. WG5: AM586_09305Help
Entry
AM586_09305       CDS       T04122                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
masw  Massilia sp. WG5
Pathway
masw00230  Purine metabolism
masw00240  Pyrimidine metabolism
masw00760  Nicotinate and nicotinamide metabolism
masw01100  Metabolic pathways
masw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AM586_09305
   00240 Pyrimidine metabolism
    AM586_09305
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AM586_09305
Enzymes [BR:masw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     AM586_09305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-ProteinID: ALK96448
Position
complement(5295439..5296452)
Genome map
AA seq 337 aa AA seqDB search
MPLDLSDTLVVGISATALFDLAEADAVFKAKYAKNPQSALEEYRAYMLERENEPLRDGTG
MPLVRALLGLNRFAPSESRPLVEVVVMSRNSPETGVRVFNNIRSRGLAISRHAFTGGQSV
VDYLDAFAVDLFLTTNVEDAQRIIDAQACAAAVLKPPPSTGEAPLEDQVRIAFDGDAVLF
DDSSELVYKTEGLGRFHTVEDEKQNEPMKDGPYAILLRKLARLQQSLPFGADTSPVRIAI
VTARSAPAEMRVINTLRHWGVYVNEIFFLGGVPKSKVVKAFRAHIFFDDQDLHLDPVAKH
VPSGRVPYRSDSPLFTPPLGIELADEPPLLVEKLETN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcgacctctcagacaccctcgtcgtcggcatctccgccaccgccctgttcgac
ctggccgaagcggacgccgtctttaaagccaagtacgcgaagaacccgcaaagcgcgctc
gaggagtaccgcgcctacatgctggaacgcgaaaacgagcccttgcgcgatggcaccggc
atgccgctggtgcgcgccctgctcggcctgaaccgcttcgcgccgtccgaatccaggccg
ctggtcgaagtcgtggtcatgtcgcgcaacagccccgagaccggggtgcgggtcttcaac
aacatccgctcgcgcggcctggccatctcgcgccatgcctttaccggcgggcagtcggtg
gtcgattacctggacgccttcgcggtcgacctgttcctgaccaccaacgtcgaagacgcc
cagcgcatcatcgacgcccaggcctgcgccgccgccgtgctgaagccgccgccgagcacg
ggcgaggcgccgctcgaagaccaggtgcgcatcgccttcgacggcgacgccgtgctgttc
gacgattcaagcgaactggtctacaagaccgagggcctgggccgcttccacacggtcgag
gacgaaaagcagaacgaaccgatgaaggacgggccgtatgcgatcctgctgcgcaagctg
gccaggctgcagcaaagcctgcccttcggcgcggatacctcaccggtgcgcatcgccatc
gtcaccgcacgcagcgcgccggccgagatgcgggtcatcaataccctgcgccactggggg
gtctatgtgaacgagatcttcttcctcggcggcgtgcccaagtcgaaggtggtgaaggct
ttccgcgcccatatcttcttcgacgaccaggacctgcacctcgatccggtcgccaagcat
gtgccgtccggccgcgtgccctaccgctcggactccccgctgttcaccccgccgctgggc
atcgaactggccgacgagccgccgctgctggtcgaaaagctcgaaaccaactga

DBGET integrated database retrieval system