KEGG   Massilia sp. WG5: AM586_13340Help
Entry
AM586_13340       CDS       T04122                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
masw  Massilia sp. WG5
Pathway
masw00071  Fatty acid degradation
masw00072  Synthesis and degradation of ketone bodies
masw00280  Valine, leucine and isoleucine degradation
masw00310  Lysine degradation
masw00362  Benzoate degradation
masw00380  Tryptophan metabolism
masw00620  Pyruvate metabolism
masw00630  Glyoxylate and dicarboxylate metabolism
masw00640  Propanoate metabolism
masw00650  Butanoate metabolism
masw00900  Terpenoid backbone biosynthesis
masw01100  Metabolic pathways
masw01110  Biosynthesis of secondary metabolites
masw01120  Microbial metabolism in diverse environments
masw01130  Biosynthesis of antibiotics
masw01200  Carbon metabolism
masw01212  Fatty acid metabolism
masw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM586_13340
   00630 Glyoxylate and dicarboxylate metabolism
    AM586_13340
   00640 Propanoate metabolism
    AM586_13340
   00650 Butanoate metabolism
    AM586_13340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AM586_13340
   00072 Synthesis and degradation of ketone bodies
    AM586_13340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AM586_13340
   00310 Lysine degradation
    AM586_13340
   00380 Tryptophan metabolism
    AM586_13340
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AM586_13340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AM586_13340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AM586_13340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:masw04147]
    AM586_13340
Enzymes [BR:masw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AM586_13340
Exosome [BR:masw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AM586_13340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALK97086
Position
complement(90385..91587)
Genome map
AA seq 400 aa AA seqDB search
MLDAYIYAGLRTPFGRLAGALAPARPDDLVASVIRKLLADSSFDAAQVEDVILGCAGQAG
EDSRNIARHAVLLSGLPHTVPGQTVNRLCSSGLAAVLDAARAISSGEGELYVAGGVESMS
RAPFVVAKSESAFGREFKVFDSALGARFPNPRITREFGGDTMPETADNVARDLGLGREDS
DRFAALSQARYAAALADGFFAGEIMPVEVPTGKKTPPRLVSEDEQPRPESTVDTLARLKA
LQEGGVVTAGNSSSLNDGAAALLIGSRAAGERAGVRPMARILAGAAVGVEPRVMGLGPAY
AIPKALARAGLSLADMDLIEINEAFAAQVLGCLKLLDVAFDDPRVNPNGGAIAVGHPLGA
SGARLALSAARELERRNGRYAVISLCIGVGQGLAVVIERT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcttacatctacgccggcctgcgcacgcccttcggccgccttgccggcgcc
ctcgccccggcccgcccggacgacctggtggcctccgtcatccgcaagctgcttgccgac
tcgtccttcgacgccgcccaggtcgaggacgtgatcctcggctgcgccggccaggccggc
gaggacagccgcaacatcgcgcgccatgccgtgctgctgtccggcctgccgcacacggtt
cccggccagaccgtcaaccgcctctgctccagcggcctggccgcggtgctcgacgccgcc
cgcgccatcagcagcggcgaaggcgagctgtatgtcgccggcggcgtcgagagcatgagc
cgcgcacccttcgtggtggccaagagcgaatccgctttcggccgcgagttcaaggtgttc
gactccgccctcggcgcgcgcttcccgaacccgcgcatcacccgggagttcggcggcgat
accatgccggaaacggcggacaacgtggcgcgcgacctcggcctcggccgggaagacagc
gaccgcttcgccgccctctcgcaggcacgctacgccgccgccctggcggatggcttcttc
gccggcgagatcatgccggtcgaggtcccgaccgggaagaagacgccgccgcgcctcgtg
tccgaggacgagcagccgcgtccggaatcgacggtcgacacgctggccaggctgaaggca
ctgcaggaaggcggcgtggtcacggccggcaactcctccagcctgaacgacggcgctgcc
gcactcctcatcggcagccgcgcggccggcgagcgggccggggtcaggccgatggcccgc
atcctggccggggccgccgtcggcgtcgagccgcgcgtgatgggccttggcccggcgtac
gcgatcccgaaggctttggcgcgcgccggcctgagcctggccgacatggacctcatcgag
atcaacgaagccttcgcagcccaggtgctcggctgcctgaaactgctggatgtagccttc
gacgacccgcgtgtgaatccgaacggcggcgcgatcgccgtaggccacccgctcggcgca
tccggggcccgcctggccctgagcgccgcccgcgaactggaacgccgcaatggccgctac
gccgtcatcagcctgtgcatcggcgtcggccagggcctggccgtcgtcatcgaacgcacc
tga

DBGET integrated database retrieval system