KEGG   Massilia sp. WG5: AM586_16610Help
Entry
AM586_16610       CDS       T04122                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
masw  Massilia sp. WG5
Pathway
masw00040  Pentose and glucuronate interconversions
masw00053  Ascorbate and aldarate metabolism
masw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AM586_16610
   00053 Ascorbate and aldarate metabolism
    AM586_16610
Enzymes [BR:masw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AM586_16610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALK97595
Position
873083..874663
Genome map
AA seq 526 aa AA seqDB search
MTIQGEMIIGRRVVRGSAGSLRAFNPATRAEMEPAFGLATALEVEAACALAEQAFDAYRN
VSLERRARFLETIADRIMDIGPALVERASQESGLPAARIEGERGRTCNQLRLFAKVVRDG
HFLEATLDSALPQRTPPRPDLRMRKIALGPVAVFGASNFPLAFSVAGGDTASALAAGCPV
VVKAHSAHPGTSELVGKAVLAAAIECDMPEGVFSMLIGEGRQVGQALVANPAIKAVGFTG
SRQGGMALVHTASARKEPIPVYAEMSSINPFYLLPGALAGNTAKLGQGFIDSLTMGVGQF
CTNPGLVIGLAGADFDAFRAAAAQALQAKSAGTMLTAGIHKAYTSAIEKRSGIVGVELVG
QGSAEGQGCAAQGALYQTNASTFLANPDLEEEIFGPASLMIACRDEAELLAVTNHVEGQL
TATVHASAADRLLAAKLLPVLERKAGRILFNGYPTGVEVCHAMVHGGPFPATSDTRSTSV
GATAIERFLRPVCYQDLPADLLPEALRDDNPLGLTRMVDGQLQVAG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcaaggtgaaatgatcatcggccgccgcgtcgtgcgcggcagcgccggcagc
ctgcgcgccttcaacccggccacgcgcgccgagatggaaccggccttcggcctggccacc
gctctggaggtcgaggccgcctgcgcgctggccgagcaggccttcgatgcctaccgcaac
gtgtcgctggagcgccgcgcgcgcttcctggaaaccatcgccgaccgcatcatggacatc
ggcccggcgctggtggagcgcgccagccaggaatccggcctgcccgccgcccgcatcgag
ggcgaacgcggccgcacctgcaaccagctgcgcctgttcgccaaggtcgtccgcgacggc
cacttcctggaagcgacgctggactccgccctgccccagcgcacgccgccgcgtccggac
ctgcgcatgcgcaagatcgcgctcggcccggtcgccgtgttcggcgcctccaacttcccg
ctcgccttctcggtggccggcggcgataccgcatccgcgctggcggccggctgcccggtc
gtggtcaaggcccacagcgcccacccgggcacctcggaactggtcggcaaggccgtgctt
gccgccgccatcgaatgcgacatgccggaaggcgtgttctcgatgctgatcggcgaaggc
cgccaggtcggccaggccctggtcgccaacccggcgatcaaggcggtcggcttcaccggc
tcgcgccagggcggcatggccctcgtgcacacggcgagcgcacgcaaggaaccgatcccg
gtgtacgccgagatgagctcgatcaaccccttctacctgctgccgggcgcactggcgggc
aacaccgccaaactgggccagggcttcatcgactcgctgaccatgggcgtgggccagttc
tgcaccaacccgggcctggtgatcggcctggccggcgccgacttcgacgccttccgcgcc
gccgccgcgcaggcgctgcaggccaagagcgccggcaccatgctgaccgccggcatccac
aaggcttataccagcgcaatcgagaagcgttccggcatcgtcggcgtggaactggtcgga
cagggttcggccgaaggccagggctgcgccgcccagggcgcgctgtaccagaccaatgcc
tcgaccttcctcgcgaatccggacctggaagaagagatcttcggcccggcctcgctgatg
atcgcctgccgcgacgaagccgaactgctggccgtgacgaatcacgtcgaaggccagctg
acggcgaccgtgcatgcctccgccgccgaccggctgcttgccgcgaagctgctgccggtc
ctggaacgcaaggccggccgcatcctgttcaacggctacccgaccggcgtcgaagtctgc
cacgcgatggtgcacggcggccccttcccggcgacctccgatacgcgctcgaccagcgtc
ggcgcgaccgcgatcgagcgcttcctgcgcccggtgtgctaccaggacctgccggcggac
ctgctgccggaagccctgcgcgacgacaatccgctcggcctgacccgcatggtcgacggc
cagctgcaggtggccggctaa

DBGET integrated database retrieval system