KEGG   Massilia sp. WG5: AM586_19190Help
Entry
AM586_19190       CDS       T04122                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
masw  Massilia sp. WG5
Pathway
masw00450  Selenocompound metabolism
masw00970  Aminoacyl-tRNA biosynthesis
masw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AM586_19190
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AM586_19190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:masw01007]
    AM586_19190
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:masw03016]
    AM586_19190
Enzymes [BR:masw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AM586_19190
Amino acid related enzymes [BR:masw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AM586_19190
Transfer RNA biogenesis [BR:masw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AM586_19190
 Prokaryotic type
   Other AARSs
    AM586_19190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ALK99713
Position
1486964..1489117
Genome map
AA seq 717 aa AA seqDB search
MTRKLFVTTALPYANAAFHIGHMMEYIQADIWVRFQRMQKDGNEQRVVHFVGADDTHGTP
IMIAAEKEGVTPQEFVARIAAGRAQYLDGFHIAFDNWYSTDSPENVELSQGIYRKLVDAG
LIYTKTVDRFYDPTKGMFLADRNIKGECPVCHAKDQYGDNCEVCGAAYQPTELINPYSVF
TGSTPILKPSEQYFFKLSDPRCFQFLKEWLNTPGRLQPEMVNKVSEWLGENGEKLADWDI
SRDAPYFGIPIPDAPGKFFYVWLDAPVGYLASLKNYFAKKGIDYEAFLKDPSAEQVHFIG
KDIVSFHLLFWPAMLNFSNHPVIDKLKVNVHGHLTVNNEKMSKSRGTGISPLRYLELKMN
PEWLRYYLAFKLNSKVEDLDFTGEDFVARVNSDLIGKYVNIASRCAGFIAKKFDGKLATE
LSPKAHEWIARALSGEDGERQAAIAASYEAREFGRALREVMAIADVANQYVDENKPWLLA
KDETKTAELHEVCTTALILFRQLTIMLSPVLPHVAGRVQEFLGDAAFSWDDTKGENVYDT
VLGRSIGAYSHLMQRVDAKMVEDLFDKPAAVPAAAPAAAPAPAAAASAGNAEAVGTAGDI
EELAPEISIDDFTKVDLRVAKIVNCEHVEGSSKLLRLTLDVGEGRLRNVFSGIKSAYQPE
QLIGKLTVMVANLAPRKMKFGVSEGMVLCASSKDEKTNPGLYLLEPVSGAQPGMRIR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaagctgttcgtcaccaccgccctgccctatgccaacgccgccttccacatc
ggtcacatgatggaatacatccaggccgacatctgggtccgcttccagcgcatgcagaaa
gatggcaacgagcagcgcgtggtgcacttcgtcggcgccgacgacacccacggcaccccg
atcatgatcgccgccgagaaggaaggcgtgacgccgcaggaattcgtggcccgcatcgcc
gccggccgcgcccagtacctggacggcttccacatcgccttcgacaactggtattcgacc
gattcgccggaaaacgtcgagctctcgcagggtatctaccgcaagctggttgacgccggc
ctcatctataccaaaaccgtcgaccgcttctacgatccgaccaagggcatgttcctggcc
gaccgcaacatcaagggcgagtgcccggtctgccacgccaaggaccagtacggcgacaac
tgcgaagtctgcggcgccgcctaccagccgaccgaactgatcaacccgtactcggtgttc
accggttcgaccccgatcctgaagccgtccgagcagtacttcttcaagctgtccgacccg
cgctgcttccagttcctgaaggagtggctgaacaccccgggccgcctgcagccggaaatg
gtcaacaaggtctcggaatggctgggcgagaacggcgaaaagctggccgactgggatatc
tcccgtgacgcgccctacttcggcatcccgattccggatgcgccgggcaagttcttctac
gtctggctggacgcgccggtcggctacctggcctcgctgaagaattacttcgccaagaaa
ggcatcgactacgaagccttcctgaaagatccgtcggccgagcaagttcacttcatcggc
aaggacatcgtgtccttccacctgctattctggccggcgatgctgaacttctcgaaccac
ccggtgatcgacaagctgaaggtgaatgtccacggccacctgaccgtgaacaacgaaaag
atgtcgaagtcgcgcggcaccggcatctcgccgctgcgctacctggaactgaagatgaat
ccggagtggctgcgctactacctggcattcaagctgaacagcaaggtcgaggacctggac
ttcaccggcgaggacttcgtcgcccgcgtgaacagcgacctgatcggtaagtacgtgaac
atcgccagccgctgcgccggcttcatcgccaagaaattcgacggcaagctggccaccgaa
ctgtcgcccaaggcgcacgagtggatcgcccgcgccctgagcggcgaggacggcgagcgc
caggccgccatcgccgccagctatgaagcccgcgaattcggccgcgccctgcgcgaagtg
atggccatcgccgacgtcgccaaccagtacgtggacgagaacaagccctggctgctggcc
aaggacgagaccaaaaccgcggagctgcacgaagtctgcaccaccgccctgatcctgttc
cgccagctgaccatcatgctgtcgccggtgctgccgcacgtggccgggcgcgtccaggaa
ttcctgggcgacgcggccttctcgtgggacgacacgaagggcgagaacgtgtacgacacg
gtgctgggccgcagcatcggcgcctacagccacctgatgcagcgcgtcgacgccaagatg
gtcgaagacctgttcgacaagccggccgctgtaccggctgcggccccggccgccgcgccc
gcgccggcagccgccgcaagcgccggaaatgctgaggcagttggaaccgccggcgatatc
gaggaacttgctcccgaaatctcgatcgatgatttcacgaaggtcgacctgcgcgtggcg
aagatcgtcaattgcgagcacgtcgaagggtcgagcaagctgctgcgcctgaccctggac
gtcggcgaaggccgtctgcgcaatgtattctcgggcatcaagtcggcctaccagccggaa
cagctgatcggcaagctgaccgtgatggtcgccaacctggcgccgcgcaagatgaagttc
ggcgtgtcggaaggcatggtgctgtgcgcatcgagcaaggacgagaagacgaacccgggc
ctgtacctgctcgagccggtgagcggcgcccagccgggcatgcgcatccgctga

DBGET integrated database retrieval system