KEGG   Massilia sp. WG5: AM586_20435Help
Entry
AM586_20435       CDS       T04122                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
masw  Massilia sp. WG5
Pathway
masw00230  Purine metabolism
masw00250  Alanine, aspartate and glutamate metabolism
masw01100  Metabolic pathways
Module
masw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AM586_20435
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AM586_20435
Enzymes [BR:masw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AM586_20435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ALK98198
Position
complement(1742324..1743634)
Genome map
AA seq 436 aa AA seqDB search
MSNTAKNVVVIGTQWGDEGKGKIVDWLTDHAAGVVRFQGGHNAGHTLVIKGQKTALQLIP
SGIMREGVACYIGNGVVVSVPDVMREIDKLEAAGVEVASRLKISEACPVILPYHVAIDVA
REAARGVNKIGTTGKGIGPAYEDKVARRAIRIADMLNETRFAEKLRENLDYHNFVLTGYL
KAQAIDFQKTFDDAMALVPRLRPMVGDVSSALYAAHKAGGSLLFEGAQGSLLDVDHGTYP
FVTSSNCVAGNAAAGSGVGPGMLHYIMGITKAYTTRVGSGPFPSELPTDAGVGEHLSRVG
HEFGTVTGRARRCGWFDAALLRRSVQINGVTGMCLTKLDVLDGIESLKLCTGYKIDGRDV
DIFPVGAEEAAACVPVYEEMPGWKESTVGAKSMDELPANARAYIKRIEELVGVPIDMVST
GPDRVETIVLRHPFAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatactgctaagaacgtcgttgtcatcggcacccagtggggcgatgaaggcaag
ggtaagatcgtcgactggctgaccgaccacgccgccggcgtggtgcgcttccagggcggc
cataacgccggccacacgctggtgatcaagggccagaagaccgccctccagctgatcccg
tcgggcatcatgcgcgaaggcgtggcctgctacatcggcaacggcgtcgtggtgtcggtg
ccggacgtgatgcgcgaaatcgacaagctcgaagccgccggcgtcgaagtcgcgtcgcgc
ctgaagatctcggaagcctgcccggtcatcctgccctaccacgtcgccatcgacgtcgcc
cgcgaagccgcgcgcggcgtcaacaagatcggcaccaccggcaagggcatcggcccggcc
tacgaagacaaggtggcgcgccgcgcgatccgtatcgccgacatgctgaacgaaacccgc
ttcgccgagaagctgcgcgagaacctggactaccataacttcgtgctgaccggttacctg
aaagcccaggcaatcgacttccagaagaccttcgacgacgcgatggccctggtgccgcgc
ctgcgtccgatggtcggcgacgtctcctcggcactgtacgccgcgcacaaggccggcggc
agcctgctgttcgaaggcgcccagggttcgctgctcgacgtcgaccacggcacctatccg
ttcgtgacctcgtcgaactgcgtggccggcaacgccgccgccggttcgggcgtgggcccg
ggcatgctgcactacatcatgggcatcaccaaggcctacacgacccgcgtgggttcgggc
ccgttcccgtcggaactgccgaccgacgccggcgtcggcgagcacctgtcgcgcgtgggc
cacgagttcggcaccgtgaccggccgtgcgcgccgctgcggctggttcgacgccgcgctg
ctgcgccgctcggtccagatcaacggcgtgaccggcatgtgcctgaccaagctggacgtg
ctggacggcatcgaatccctgaagctgtgcaccggctacaagatcgacggccgtgacgtc
gacatcttcccggtcggcgcggaagaggcggccgcctgcgtgccggtctacgaagaaatg
ccgggctggaaggaaagcaccgtcggcgccaagtccatggacgaactgccggccaatgcc
cgcgcttacatcaagcgcatcgaagaactggtcggcgtcccgatcgacatggtgtcgacc
ggcccggaccgcgttgaaaccatcgtgctgcgtcacccgttcgccgcctga

DBGET integrated database retrieval system