KEGG   Massilia sp. WG5: AM586_27480
Entry
AM586_27480       CDS       T04122                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
masw  Massilia sp. WG5
Pathway
masw00626  Naphthalene degradation
masw01100  Metabolic pathways
masw01120  Microbial metabolism in diverse environments
masw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AM586_27480
Enzymes [BR:masw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     AM586_27480
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ALK99982
Position
unnamed_1:52285..53283
AA seq 332 aa
MSKSRLLNPSDIHGVWSILPTPAKPGASDWRATDTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVATAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARLDDFVDGFWSSGTVCGPLVSTTLRDKVIE
ARRTKDWGDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKRRIDAGGWMNAGPVRPPYN
DICPENYLDSWKRSGERWAELHKQLEKEMSEK
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagtaagtcaagattgttgaatccatcagacattcacggcgtttggtcgattcttccc
acaccagccaaacccggagcgagcgactggcgtgctactgacaccgttgatctggatgag
acggcccgcgctgtcgaaggacttatcgcggctggcgccaacgggattctgagcatgggg
actttgggcgagtgcgaatcgttgacctgggaggaaaagaaggtcttcatgcaaaccatc
gtcgagaccgccaggggcagggttcccgtgttcgttggtactacaacgctcaatacccgc
gatacgatcgagcagaccaggtacgcccactccattggggccgacggaacaatgctgggc
atccctatgtggtgcaatccctgcgttgatatggctgttcagtactacaaggatgtcgcc
acagctgttccggagatgaatatcgccatctacgcgaataccgaggcgttcaaatttgat
ttcccccgggcgttctgggcgcgcgtgtcagagatccggcaagtcgttgcggctaaatat
atcggtatcgagttcctgcttcaggatctgcatctcaccaagcaccgcatgaagctgttg
ccgctcgactaccaatactatgctgcggcacgtttggatgacttcgttgatggcttctgg
tccagcggtacggtatgcggtccattggtttcaactacgcttcgggacaaggtcatcgaa
gcccggcgaaccaaagactggggggatgcgcacgcatttcagggccggcttgtgaagacg
gctgcgcccttccccgaagatagcttcaaaaccttctcaatttacaacgttgctctcgaa
aagcgacggatcgatgccggcggctggatgaacgccggccccgtgcgcccaccttataac
gacatttgtcccgagaactatctcgattcttggaagcgttcaggggaacgctgggccgaa
ttgcacaagcagcttgaaaaggaaatgtcggaaaaatag

DBGET integrated database retrieval system