KEGG   Massilia sp. YMA4: DPH57_00370Help
Entry
DPH57_00370       CDS       T05528                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
masy  Massilia sp. YMA4
Brite
KEGG Orthology (KO) [BR:masy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DPH57_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXA89765
UniProt: A0A344J9K6
Position
74712..75722
Genome map
AA seq 336 aa AA seqDB search
MQTLQISIYALAVLIFLALVFDFMNGFHDAANAIATVVSTGVLKPQSAVAMAAFFNFIAI
FIVGLKVAQTIGKGTIDPHVVDHYVIFGALVGAIVWNLITWYYGIPSSSSHALIGGLVGA
AVAKSGTGALIAGGLMKTVMFIVLAPLLGFVLGSIIMLIVSWVFVKSTPRKIDGWFRRLQ
LASAAAYSLGHGGNDAQKTMGIIWMLLIASGHVAATDAEPPLWVIIACYATISFGTLFGG
WRIVKTMGQKITKLKPVGGFCAETGGALTLIMASFWGVPVSTTHTITGAIVGVGSAQRLS
AVRWGVAGNIVWAWIFTIPASAFVAAIAWWLGRHIM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctacaaatcagcatctacgcgctggctgtactgatcttcctggcactcgtc
ttcgacttcatgaacggcttccacgacgccgccaacgcgatcgcgacggtggtgtcgacg
ggcgtgctgaagccgcagtcggcggtggcgatggccgccttcttcaacttcatcgcgatc
ttcatcgtcgggctgaaagtggcccagaccatcggcaagggcaccatcgatccgcacgtg
gtggaccattacgtcatcttcggcgcgctggtcggcgccatcgtctggaacctgatcacg
tggtactacggcattccgtcgtcgtcgtcgcacgcgctgatcggcggcctggtgggcgcg
gccgtcgccaagtccggtaccggcgcgctgatcgccggcggcctgatgaagaccgtcatg
ttcatcgtgctggcaccgctcctgggcttcgtgctgggttccatcatcatgctgatcgtc
tcgtgggtgttcgtcaaatcgacgccacgcaagatcgacggctggttccgccgcctgcag
ctggcttccgccgccgcctacagcctgggtcacggcggcaacgacgcgcagaaaaccatg
ggcatcatctggatgctgctgatcgcctccggccacgtggccgcgaccgatgccgagccg
ccgctgtgggtcatcatcgcctgctacgcgacgatctcgttcggcacgctgttcggcggc
tggcgcatcgtgaaaaccatgggccagaagatcacgaagctcaaacccgtcggcggcttc
tgcgccgagaccggcggcgcgctgaccctgatcatggcgtcgttctggggcgtgcccgtc
tcgacgacgcacacgatcacgggcgccatcgtcggcgtcggctcggcgcagcgcctgtcg
gccgtgcgctggggcgtggccggcaatatcgtgtgggcatggatcttcacgattcccgct
tccgcgttcgtggccgccatcgcctggtggctgggtcgccacatcatgtaa

DBGET integrated database retrieval system