KEGG   Massilia sp. YMA4: DPH57_02360Help
Entry
DPH57_02360       CDS       T05528                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
masy  Massilia sp. YMA4
Pathway
masy00450  Selenocompound metabolism
masy00970  Aminoacyl-tRNA biosynthesis
masy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DPH57_02360
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DPH57_02360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:masy01007]
    DPH57_02360
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:masy03016]
    DPH57_02360
Enzymes [BR:masy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DPH57_02360
Amino acid related enzymes [BR:masy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DPH57_02360
Transfer RNA biogenesis [BR:masy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DPH57_02360
 Prokaryotic type
   Other AARSs
    DPH57_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AXA90119
UniProt: A0A344JAL0
Position
complement(518649..520775)
Genome map
AA seq 708 aa AA seqDB search
MTRKLFVTTALPYANAAFHIGHMMEYIQADIWVRYQRMQQDREVHFVGADDTHGTPIMIA
AEKEGITPQEFVAKIAAGRAQYLDGFHIAFDNWYSTDSPENVELSQGIYRRLRDVGLIQT
KTVDRFFDPVKGMFLADRNIKGECPKCGAKDQYGDNCEVCGAAYQPTDLVNPYSVFTSAT
PILKPSEQYFFKLSDPRCFEFLRDWLNTPGRLQPEMVNKVSEWLGESGEKLADWDISRDA
PYFGIPIPDAPGKFFYVWLDAPVGYLASLKNYFSKKGIDFDAFLNDPAAEQIHFIGKDIV
SFHLLFWPAMLKFADHPVIDKLKVNVHGHLTVNNEKMSKSRGTGISPLRYLNLGMNPEWL
RYYIAFKLNSKVEDLDFTGEDFVARVNSDLIGKYVNIASRCAGFIAKKFDGKLADSLSAT
SLGWIRRALTNAEGAERQVTIADSYEQREFGRALREIMEIADVTNQYVDENKPWVLAKDE
TKLAELHEVCTTALILFRQLTILLSPVLPGVAANVRTFLNDERHSWADTTLAAASTSMLG
RAIGAYSHLMTRVDAKMIDDLFDAPKPAAAPAPAVAAPTAAAAAPAAPEGIEPPAPEIKI
DDFAKVDLRIARIVNCEHVEGSDKLLRLTLDVGEGRHRNVFSGIKSMYQPEDLVGKLTVM
VANLAPRKMKFGISEGMVLAASSADEKANPGIYILNPWPGAQPGMRIR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagctgttcgtcaccaccgccctgccctatgccaacgccgcgttccacatc
ggccacatgatggaatacatccaggccgacatctgggtccgctaccagcgcatgcagcag
gaccgcgaggtgcacttcgtgggcgccgacgacacccacggcacgccgatcatgatcgcc
gccgagaaggaaggcatcacgccgcaggaattcgtcgccaagatcgccgccggccgcgcg
caatacctggacggttttcatatcgcctttgacaactggtattcgaccgattcgccggaa
aacgtcgagctgtcgcagggcatctaccgccgcctgcgcgacgtcggcctgatccagacg
aaaaccgtcgaccgcttcttcgaccccgtcaagggcatgttcctcgccgaccgcaacatc
aagggcgagtgcccgaaatgcggcgccaaggaccagtatggcgacaattgcgaggtgtgc
ggcgcggcctaccagccgaccgacctggtcaacccgtactccgtgttcaccagcgcgacg
ccgatcctgaagccgtccgagcagtatttcttcaagctgtccgacccgcgctgcttcgag
ttcctgcgcgactggctcaacaccccgggccgcctgcagccggaaatggtcaacaaggtc
tcggaatggctgggcgagtccggcgaaaagctggccgactgggacatctcgcgcgacgcg
ccctacttcggcatcccgatcccggacgcgccgggcaagttcttctacgtctggctggac
gcgccggtcggctacctggcctcgctgaagaactacttcagcaagaagggcatcgacttc
gacgccttcctgaacgacccggccgccgagcagatccacttcatcggcaaggacatcgtc
tcgttccacctgctgttctggccggcgatgctgaagttcgccgaccacccggtgatcgac
aagctgaaggtcaacgtacacggccacctgaccgtcaacaatgaaaaaatgtccaagtcg
cgcggcaccggcatctcgccgctgcgctacctgaacctgggcatgaatccggagtggctg
cgctactacatcgccttcaagctgaactccaaggtggaagacctggacttcacgggcgag
gactttgtcgcccgcgtcaactcggacctgatcggcaagtacgtcaacatcgccagccgc
tgcgccggcttcatcgccaagaagttcgacggcaagctggcggacagcctgtcggcaacc
tcgctgggctggatccgccgcgcgctgacgaacgccgaaggcgccgagcgccaggtgacg
atcgcggacagctacgagcagcgcgaattcggccgcgccctgcgcgagatcatggagatc
gccgacgtgacgaaccagtacgtcgacgaaaacaagccgtgggtgctggccaaggatgaa
accaaactggccgaactgcacgaggtgtgcacgacggccctgatcctgttccgccagctg
acgatcctgctgtcgccggtgctgccgggcgtggccgccaatgtgcgcacgttcctgaac
gacgagcgccacagctgggccgacacgaccctggcggccgccagcacgtcgatgctgggc
cgcgccatcggcgcctacagccacctgatgacgcgggtggacgcgaaaatgatcgacgac
ctgttcgacgcgccgaagccggcagccgccccggcacctgccgtggccgctccgaccgcg
gctgccgcggcgcccgcggcaccggaaggcatcgagccgccggcaccggaaatcaagatc
gacgacttcgccaaggtcgacctgcgcatcgcccggatcgtcaactgcgagcacgtggaa
ggctcggacaagctgctgcgcctgaccctggacgtgggcgaaggccgccaccgcaatgtt
ttctcgggcatcaagtcgatgtatcagccggaagacctggtcggtaaattgacggtgatg
gtggcgaatctggcgccgcgtaaaatgaaattcgggatttccgaaggcatggtattggcc
gcctccagcgcggacgagaaagccaatccgggtatttatatcctgaacccatggccgggc
gcgcaaccgggcatgcgtatccgctga

DBGET integrated database retrieval system