KEGG   Massilia sp. YMA4: DPH57_18535Help
Entry
DPH57_18535       CDS       T05528                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
masy  Massilia sp. YMA4
Pathway
masy00520  Amino sugar and nucleotide sugar metabolism
masy01100  Metabolic pathways
masy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:masy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DPH57_18535
Enzymes [BR:masy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DPH57_18535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AXA92970
UniProt: A0A344JIR1
Position
4321020..4322099
Genome map
AA seq 359 aa AA seqDB search
MLAGRILTPEGWVTGTIEFGQRIDRIAAAPADTGLTILPGFIDLHVHGAAGVDIMRGGDA
GAVVAREHARHGTTSLLGTTMTAHEPAIRHALAGLAGVIAQRPERGARMLGVHLEGPFIS
AHRLGAQPPHVMPATLELVRSLDAIAPIRVLTMAPEVPGHLALIPQLAALGMRVQVGHSN
GSYDDGVAALRAGATGFTHLFNGMTGMDHYQPGIVDAALAHAEYAEIIPDLQHVHPGAIL
AALRAIPRAYGITDATAATGMPDGEYALGSQRVYKCLGCVRLATGSLAGSVLTMDQALRN
LVGMGLDLADASHRLSLYPADYLGETERGRLVPGAWADIVVLDQDLQPVAVHVEGEAIL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaggcaggattcttacaccggaaggctgggtcaccggcaccatcgaattcggc
cagcgtatcgaccgcatcgcggcggcgccggccgataccgggctgaccatcctgcctggc
ttcatcgacctgcacgtgcacggcgccgccggcgtggacatcatgcgcggcggcgatgcc
ggcgctgtcgtggcgcgcgaacatgcgcgccatggcaccacctccctgctgggcaccacc
atgacggcgcacgagccggcgatccggcatgcgctggcggggctggccggcgtgatcgcg
cagcgccccgagcgtggtgcgcgcatgctgggcgtgcacctggaaggcccgttcatcagc
gcgcaccggctgggcgcgcaaccgccgcacgtgatgccggccacgctggagctggtgcga
agcctggatgccatcgcgccgatccgcgtgctgacgatggcgccggaggtgcccggccac
ctagccctgatcccgcagctggcggcactgggcatgcgcgtgcaggtcggccactcgaac
ggcagctacgacgacggcgtggcggcgctgcgggccggcgcgaccggcttcacccacctg
ttcaacggcatgacgggcatggaccattaccagcccggcatcgtcgacgcggcgctggcc
cacgccgaatatgccgagatcattcccgacctgcagcacgtccacccgggcgccatcctg
gccgcgctgcgcgcgatcccgcgcgcctacggcatcaccgacgctaccgcggccaccggc
atgccggatggcgaatatgcactgggctcgcagcgcgtctacaaatgcctgggctgcgtg
cggttggcgaccggctcgctggccggcagcgtgctgacgatggaccaggcgctgcgcaac
ctggtcggcatgggcctggacctggccgacgcgtcgcaccgcttgtcgctgtaccccgcc
gactacctgggcgagaccgagcgcggtcgcctggtccccggcgcctgggccgatatcgtg
gtcctcgaccaggacctgcaaccggtcgccgtccatgtggaaggcgaagccattctgtga

DBGET integrated database retrieval system