KEGG   Massilia armeniaca: C9I28_06015Help
Entry
C9I28_06015       CDS       T05378                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
masz  Massilia armeniaca
Pathway
masz00860  Porphyrin and chlorophyll metabolism
masz01100  Metabolic pathways
Module
masz_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C9I28_06015
Enzymes [BR:masz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     C9I28_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AVR95328
UniProt: A0A2R4C709
Position
complement(1370005..1371447)
Genome map
AA seq 480 aa AA seqDB search
MTFPYSTLMVQGTTSDAGKSTVVAALCRLLKRQGIAVAPFKPQNMALNSAVTADGGEIGR
AQALQAIAAGVAPHTDMNPVLLKPSSDTGAQVIIHGKVRAEMNARDYHQYKTVAMAAVLE
SHARLLRQYETVIVEGAGSPAEINLRERDIANMGFAEAVDCPVVLVADIDRGGVFAHIVG
TLACLSDSERQRIVGFVINRFRGDIKLLEPGLEWLERQTGKPVLAVLPYLHGLFLDAEDA
VQAVQAQRGAFRVVVPSTPRMSNHTDFDALRAHPDVDLRFVRAGEPVPPADLIVLPGSKN
TRGDLAWLVAQGWPERIARHLRYGGKVIGICGGFQMLGLAVRDPYGVEGAAGESAGLGLL
DMVTILTREKRLQQVSGQCAFAAADVAGYEIHMGASTGDALDRPAFRIDGRPEGARSFDD
QVLGTYLHGLFDTPQACQALLRWAGLDSEHTVDTAALREASLERLADATAPLMERLLSLK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacatttccttactccacgctgatggtgcagggcaccacgtccgacgccggcaagagc
accgtggtcgcggcgctgtgccgcctgctgaaacggcaaggtatcgcggtggcgccattc
aagccgcagaacatggccttgaacagcgccgtcaccgccgatggcggcgagatcggccgc
gcgcaggcattgcaggcgattgccgccggggtggcgccgcacaccgacatgaatccggtg
ctgctgaaaccctccagcgataccggcgcccaggtgatcatccacggcaaggtgcgcgcc
gagatgaatgcgcgcgactaccaccagtacaagacggtcgcgatggccgccgtgctggaa
tcgcatgcgcgcctgctgcgccaatacgagaccgtgatcgtcgaaggtgccggcagcccg
gccgagatcaacctgcgcgagcgcgacatcgccaacatgggctttgccgaggcggtcgat
tgtcccgtcgtgctggtggccgacatcgatcgcggcggcgtgttcgcccacatcgtcggc
acgctggcctgcctgtccgacagcgaacggcagcgcatcgtcggcttcgtcatcaaccgc
ttccgcggcgacatcaagctgctcgaacccggcctggaatggctggagcggcagaccggc
aagcccgtgctggccgtgctgccctacctgcacggcctgttcctggacgcggaggacgcg
gtgcaggccgtgcaggcgcagcgcggcgcattccgggtggtcgtccccagcacgcccagg
atgagcaaccacaccgacttcgacgccttgcgggcccacccggacgtcgacctgcgcttc
gttcgcgcgggtgaaccggtaccgccggcggacctgatcgtcctccccggcagcaagaac
acgcgcggcgacctggcctggctggtcgcccagggctggccggagcggatcgcccgtcac
ctgcgctatggcggcaaggtgatcggcatttgcggcggcttccagatgctgggactcgcg
gtgcgcgatccgtatggcgtggaaggcgcggctggcgaatcggccggcctgggcctgctg
gacatggtgacgatcctgacgcgcgagaagcggctgcaacaggtcagcggccagtgcgcg
tttgccgcagccgacgtagcgggctacgaaatccacatgggcgcctcgacgggggatgcg
ctggaccgcccggcgtttcggatcgacggacgcccggaaggcgcccgctcgttcgacgac
caggtgctgggcacctacctgcacggcctgttcgacacgccgcaggcgtgccaggccttg
ctgcgctgggcgggactggactcggagcacaccgtcgacacggcggcgctgcgcgaggcc
agcctggagcgcctggccgatgcgaccgcgcctttgatggagcgcctgctctccctgaag
tag

DBGET integrated database retrieval system