KEGG   Massilia armeniaca: C9I28_06840Help
Entry
C9I28_06840       CDS       T05378                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
masz  Massilia armeniaca
Pathway
masz00480  Glutathione metabolism
masz00590  Arachidonic acid metabolism
masz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C9I28_06840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C9I28_06840
Enzymes [BR:masz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C9I28_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVR95469
UniProt: A0A2R4C781
Position
complement(1548280..1548765)
Genome map
AA seq 161 aa AA seqDB search
MASVFDFSAVSLAGQPVELAQYQDKVLLIVNTASACGFTPQYAGLEKLHERFQARGFAVL
GFPCNQFGKQEPGTEEEIGAFCESRFAVTFPLFAKVDVNGPEAHPLWQFLKHDAPGLFGT
ESIKWNFTKFLVRRDGSVAHRYAPTTKPEDIARDIEALLGT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgtcttcgacttctccgccgtcagcctggctggccagccggtggaactggcg
cagtaccaggacaaggtactgctgatcgtgaacacggccagcgcctgcggcttcacgccg
cagtacgccggcctggaaaagctgcacgagcgcttccaggcgcgcggcttcgccgtgctg
ggctttccgtgcaaccagttcggcaagcaggagcccggtacggaggaggaaatcggcgca
ttctgcgagtcgcgctttgccgtcacctttccgctgttcgccaaggtcgacgtcaacggc
ccggaggcccacccgctgtggcagttcctcaagcacgacgcgcccggcctgttcggcacc
gaatcgatcaagtggaacttcacgaaattcctggtacggcgcgacggcagcgtcgcccac
cgctatgcgccgaccaccaagccggaggacatcgcgcgcgatatcgaggccttgctgggc
acctga

DBGET integrated database retrieval system