KEGG   Massilia armeniaca: C9I28_09980Help
Entry
C9I28_09980       CDS       T05378                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
masz  Massilia armeniaca
Pathway
masz00640  Propanoate metabolism
masz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C9I28_09980 (acnD)
Enzymes [BR:masz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     C9I28_09980 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AVR99123
UniProt: A0A2R4CHJ0
Position
2295933..2298539
Genome map
AA seq 868 aa AA seqDB search
MNSAYRTNLPGTTLDYFDARAAVEAIEAGAYDKLPYTSRVLAENLCRRCDATQLTASLQQ
IVKRKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAQQGGDPALVNPVVPTQLVVDH
SLAVECGGFDPQAFEKNRAIEDRRNEDRFHFIDWTKHAFKNVDVIPPGNGILHQINLERM
SPVIQVDNGVAYPDTLVGTDSHTPMVDALGVIAVGVGGLEAETVMLGRASWMRLPDIVGV
QLTGRPQPGITATDIVLALTEFLRKQKVVSAYLEFFGEGAAALTLGDRATISNMAPEFGA
TAAMFYIDQQTINYLRLTGRDDELVALVELYAKQAGLWADSLVNAEYERVLSFDLSSVVR
NIAGPSNPHKRVPTSELAARGISGVVENEPGKMPDGAVIIAAITSCTNTNNPRNMIAAGL
LARNANRAGLLRKPWVKSSLAPGSKAVTLYLEEAGLLPELEALGFGVVAYACTSCNGMSG
ALDPVIQQEIVERKLYATAVLSGNRNFDGRIHPYAQQAFLASPPLVVAYAIAGTIRFDIE
KDVLGTTTDGRAIRLADLWPSDEEIDAIVAASVKPDHFRKVYIPMFARSGDAAAAVSPLY
DWRPQSTYIRRPPYWEGALAGERTLHGMRPLAILGDNITTDHLSPSNAIMLDSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPTLKNEMVVVDGQVKAGSLARIEPDGVVTRM
WEAIETYMERKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMG
VLPLEFTGGINRLTLGLDGSETYDVVGERQPRATLTLVIHRANGESLTVPVLCRLDTAEE
VAIYEAGGVLQRFAQDFLAATVPASEAA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atcaacagcgcgtaccgcacgaacctgcccggtacgaccctggattacttcgacgcgcgc
gccgccgtcgaggcgatcgaagcgggcgcctacgacaagctgccctacacctcgcgcgtg
ctggccgagaacctgtgccgccgctgcgatgccacccagttgacggcttcgctgcagcag
attgtcaaacgcaagcgcgacctggatttcccctggttcccggcgcgcgtggtgtgccac
gacatcctgggccagaccgccctggtggacctggccggcctgcgcgacgccatcgcccag
cagggcggcgacccggccctggtcaaccccgtcgtgccgacccagctggtggtcgaccac
tcgctggccgtcgaatgcggcggcttcgacccgcaggccttcgagaagaaccgcgccatc
gaggaccgccgcaacgaggaccgcttccacttcatcgactggacgaagcacgccttcaag
aacgtcgatgtgatcccgccggggaacggcatcctgcaccagatcaacctggagcgcatg
tcgcccgtgatccaggtggacaacggcgtggcctatccggacacgctggtcggcaccgac
tcgcacacgccgatggtcgatgcgctgggcgtcatcgctgtcggcgtgggcggcctggaa
gcggagacggtcatgctgggccgcgcctcgtggatgcgcctgccggacatcgtcggcgtg
cagctgacgggccggccgcagccgggcatcacggccaccgacatcgtgctggcgctgacc
gaattcctgcgcaagcagaaggtggtgtcggcctacctggagttcttcggcgagggcgcc
gcggccctgaccctgggcgaccgcgccacgatctcgaacatggcaccggagttcggcgcc
acggcggcgatgttctacatcgaccagcagaccatcaactacctgcgcctgaccggccgc
gacgacgagctggtggcgctggtcgagctgtatgccaagcaggccggcctgtgggccgac
agcctggtcaacgccgagtacgagcgcgtgctgtccttcgacctctccagcgtcgtgcgc
aatatcgccgggccgtccaatccgcacaagcgcgtgccgacctcggagctggccgcgcgc
ggcatcagtggcgtggtcgagaacgagccgggcaagatgccggacggcgccgtcatcatc
gccgcgatcaccagctgcaccaataccaataacccccgcaacatgatcgcggccggcctg
ctggcccgcaacgccaaccgcgccggcctgctgcgcaagccctgggtcaagagctcgctg
gcacccggctcgaaggccgtgaccctgtacctggaagaagcgggcctgctgccggaactg
gaggcgctgggcttcggcgtcgtcgcgtatgcctgcacctcgtgcaacggcatgtccggc
gcgctcgatcccgtcatccagcaggagatcgtggagcgcaagctgtacgccaccgctgtc
ctgtcgggcaaccgcaacttcgacggccgcatccacccgtatgcgcagcaggccttcctg
gcctcgccgccgctggtggtggcctatgcgatcgccggcacgatccgcttcgacatcgag
aaggacgtgctgggcacgacgaccgatggtcgcgcgatccgcctggccgacctgtggccg
agcgacgaggagatcgacgcgatcgtggccgccagcgtcaagccggaccacttccgcaag
gtctacatcccgatgttcgcccgcagcggcgacgcggccgccgcggtcagcccgctgtac
gactggcgcccgcaaagcacctacatccgccggccgccctactgggaaggcgccctggcg
ggcgaacgcaccttgcacggcatgcggccgctggcgatcctgggcgacaatatcacgacg
gaccacctgtcgccgtcgaacgcgatcatgctcgattcggcggccggcgaatacctggcg
aagatgggcctgccggaagaggacttcaattcgtatgccacgcaccggggcgaccacctg
acggcgcaacgcgccacgttcgccaaccccaccttgaagaacgagatggtggtggtggac
gggcaggtcaaggccggctcgctggcccgcatcgagcccgatggcgtcgtcacgcgcatg
tgggaagcgatcgagacctacatggaacgcaagcagccgctgatcatcgtggccggcgcc
gactacggccagggctcctcgcgcgactgggcggcgaagggcgtgcgcctggccggtgtc
gaggccatcgtcgcggagggttttgaacgaattcaccgcaccaacctggtcggcatgggc
gtgctgccgctggagttcacgggcggcatcaaccgcctgaccctgggcctggacggcagc
gagacgtacgacgtggtgggcgagcgccagccgcgcgccacgctgaccttggtgatccac
cgcgccaacggcgagagcctgacggtgccggtgctgtgccgcctcgacaccgccgaggaa
gtggcgatctatgaagcgggcggcgtgctgcagcgcttcgcccaggacttcctggccgcc
accgtgccggcaagcgaggccgcatga

DBGET integrated database retrieval system