KEGG   Mycoplasma arthritidis: MARTH_orf134Help
Entry
MARTH_orf134      CDS       T00724                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mat  Mycoplasma arthritidis
Pathway
mat00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MARTH_orf134 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mat01007]
    MARTH_orf134 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mat03016]
    MARTH_orf134 (argS)
   03029 Mitochondrial biogenesis [BR:mat03029]
    MARTH_orf134 (argS)
Enzymes [BR:mat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     MARTH_orf134 (argS)
Amino acid related enzymes [BR:mat01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MARTH_orf134 (argS)
Transfer RNA biogenesis [BR:mat03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MARTH_orf134 (argS)
 Prokaryotic Type
   Other AARSs
    MARTH_orf134 (argS)
Mitochondrial biogenesis [BR:mat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MARTH_orf134 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1e tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACF07071
UniProt: B3PM19
Position
128081..129706
Genome map
AA seq 541 aa AA seqDB search
MITTKEIIIASLNEALEKLEIKKPITLTEPKSYGDYSTNLALTLQKELGKPAIEIAKEIV
NAIDLKKHKEIVKVEVANPGFINFWVSNSVLSDLVNSINSLEDHYGDMSKEGKGAVNIEF
VSANPTGFLHIGHARNAAIGATLCNVLEKAGHRVVREYYVNDYGNQMNNLAASVFSRYQQ
IFNKDFPMPDDAYKGHDMTIFADAFFKKYGDKYRNVAYTEEVKKLFRDFGREIALENIKI
DLGRFGVWFDLYTSETQQYEKDRVWPVIRRLKSTYEKDGATWLNTTKGGNDDKDRVIIKG
NGESTYMCADIAYHEQKFVELHDPEKGKIIDIWGADHSGYVERIKFSFEDLGWRRDQIEI
LLFQLLRVVKNGKEIKMSKRLGTSLTLRELLDLVGKDAVRYFLIERSYNSKIDFDINKVQ
KSDETNPLFLIKYAHARCYQLLEKAQIKNPIASNLENDFAQKLTNELKEYPNLIDTMAKT
YKVNLLPPYLLKLAGAFNSFYSNVRISGDPNEQSYLALVKATKIVLANAMKLMDLDIPNK
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgattacaacaaaggaaattattattgcttcactaaatgaagctttagaaaaactcgaa
attaagaaaccaattactttaactgagccaaaaagctatggcgattattcaactaatttg
gcacttactttgcaaaaagaattaggtaaaccagcaattgaaattgctaaagaaattgtt
aatgctattgacttaaaaaaacataaagaaattgtaaaagttgaagtagcaaatccaggt
tttattaatttttgagtctcaaattctgtgctgtctgacttagtaaactcaattaactca
ttagaagatcactacggtgatatgagtaaagaaggaaaaggagcggtaaacattgagttc
gtttcagcaaacccgacaggatttttacacattggacacgctagaaacgctgctattggt
gccaccttatgcaacgttttagaaaaagccggacaccgagttgtacgtgaatattatgtt
aatgattatggaaaccaaatgaataatttggcagcttctgtttttagtcgttatcaacaa
atttttaataaagactttcccatgccagatgatgcttataaaggccatgatatgacaatt
tttgccgatgccttttttaaaaaatatggcgataaataccgtaatgtagcttacactgaa
gaagttaaaaaactattccgtgattttggaagagagattgcgcttgaaaatattaaaatt
gatttaggtcgttttggtgtttgatttgatttatacacttctgaaacccagcaatatgaa
aaagatcgtgtatgaccagttattagaagactgaaatcgacttatgaaaaagatggtgca
acttgacttaatactactaaaggtggtaatgacgacaaggaccgggtaattatcaagggt
aatggcgaatctacttacatgtgtgccgatattgcttatcatgaacaaaaattcgtagaa
cttcatgatcccgaaaaaggtaaaatcattgacatttgaggcgctgatcactctggatat
gttgaaagaatcaaattctcatttgaagatttagggtgaagacgtgaccaaattgaaatc
ttgctattccaattattaagagttgttaaaaatggtaaggaaattaaaatgtcaaaaaga
ttgggcacttcgcttactttacgtgaattgctagatttagttggcaaagatgccgttaga
tactttttaattgaaagatcatacaattcaaagatcgactttgatattaacaaggttcaa
aaatctgatgaaactaacccattatttttaattaagtatgcacatgctcgttgctaccaa
ttattagaaaaagcgcaaataaaaaacccaattgcttcaaatcttgaaaatgattttgcg
caaaagctaacaaacgaattaaaagagtaccctaatttaattgatactatggcaaaaact
tataaagttaacttgctaccaccttatttattaaaattagccggtgcctttaactcattt
tattcaaatgttagaatatcaggcgatcctaatgaacaaagttacttagcattagttaaa
gcaactaaaatcgttttagctaatgcgatgaagttaatggatttagacattcctaataaa
atgtaa

DBGET integrated database retrieval system