KEGG   Mycoplasma arthritidis: MARTH_orf383Help
Entry
MARTH_orf383      CDS       T00724                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
mat  Mycoplasma arthritidis
Pathway
mat00670  One carbon pool by folate
mat01100  Metabolic pathways
mat01120  Microbial metabolism in diverse environments
mat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MARTH_orf383 (folD)
Enzymes [BR:mat01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     MARTH_orf383 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     MARTH_orf383 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Semialdhyde_dh DUF4813
Motif
Other DBs
NCBI-ProteinID: ACF07250
UniProt: B3PMJ8
Position
complement(343795..344676)
Genome map
AA seq 293 aa AA seqDB search
MPVILDGKRLSEALQAKIAMAFSAYRGPKPILGILQVGNKEDSNIYVAHKLKVAESLGFL
TKLVKMPENSTQDEIIGTLRNAAAEVTGIIVQLPLVSNRIENLQEILDNIPIEKDIDGLS
SYNLASNYNCKDNFLSATPKGIILLLKHYNINFRSTVIALVGQSNIVGKPLAKYLSNFKN
NTIKTYVKDTPKDDLHEAKIVIVATGVYQSVTADQLANGTVLIDVGIHRQGKTIHGDLDF
ASCFKKASYITPVPGGVGPLTVVALMFNLIKALILQNPNLDHEFLSLKEFINI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccagttattcttgatggcaaacgactttctgaggcattgcaagctaagattgcaatg
gcattttcggcgtatcgaggccctaagccaattcttgggattttacaagttggcaataaa
gaagattctaatatctatgtcgctcataaattaaaagtagctgaatctttagggttttta
accaaattggtaaaaatgccagaaaatagtacacaagatgaaataattggcactttaaga
aacgccgccgctgaagtaactggcattattgttcaactaccactagtttctaatcgaatt
gagaatcttcaagaaattcttgacaacattcctatagaaaaagacatcgatgggcttagc
tcatacaatctagcttcaaattataattgcaaagataacttcctttctgctacgcctaaa
ggcatcattttgctattaaaacattacaacattaatttccgttccaccgtgattgcttta
gtgggtcagtccaatattgtcggaaaaccattggctaaatatttaagcaattttaaaaat
aatacaattaaaacatatgttaaagacacgcctaaagatgacttacatgaagcaaaaatt
gtcatagttgctactggggtgtatcaatcagtaacggccgaccaattagctaatggtact
gttttaattgacgtcggcattcatcgtcaaggtaagacaatccatggtgatttagacttt
gcttcttgttttaaaaaagccagttacatcacaccagttcccggtggagttggaccccta
acagtagtggcattgatgtttaatttaattaaagccttaattttgcaaaatccgaatttg
gatcatgaatttctatctttaaaagagtttattaacatctag

DBGET integrated database retrieval system