KEGG   Micromonospora aurantiaca: Micau_0312
Entry
Micau_0312        CDS       T01296                                 

Definition
(GenBank) large conductance mechanosensitive channel protein
  KO
K03282  large conductance mechanosensitive channel
Organism
mau  Micromonospora aurantiaca
Brite
KEGG Orthology (KO) [BR:mau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mau02000]
    Micau_0312
Transporters [BR:mau02000]
 Other transporters
  Pores ion channels [TC:1]
   Micau_0312
SSDB
Motif
Pfam: MscL DUF4538
Other DBs
NCBI-ProteinID: ADL43879
UniProt: D9T6D3
Position
complement(311150..311620)
AA seq 156 aa
MLKGFKDFIMRGNVVDLAVGVVIGAAFTGVVTQLTKSFLEPLVRVFIALITGSKDGLSGS
TPKFRGIPFDWVAFVNAAITFVLTAAALYFLVVYPMNRLAERRKRGEEPPPSAPSEEVKL
LTEIRDALLAGNHGTPGQRSALDDVLGRRQEPPAPR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgctcaagggcttcaaagacttcatcatgcgcggcaacgtcgtcgacctggcggtcggt
gtcgtcatcggcgccgcgttcaccggcgtggtgacccagctcaccaagtcgttcctggaa
ccgctggtacgcgtgttcatcgcgctgatcaccggcagcaaggacggcctcagcggctcg
accccgaagttccggggcatcccgttcgactgggtggccttcgtcaacgcggcgatcacg
ttcgtgctcaccgcggcggcgctgtacttcctcgtcgtctacccgatgaacaggctcgcc
gagcggcgcaagcgcggcgaggagccgccgccctcggcccccagcgaggaggtcaagctg
ctcaccgagatccgggacgcgctgctcgccggcaaccacggcacgcccggccagcgcagc
gccctggacgacgtgctcggccgccggcaggagccgcccgcgccgcgctga

DBGET integrated database retrieval system