KEGG   Micromonospora aurantiaca: Micau_2018Help
Entry
Micau_2018        CDS       T01296                                 

Definition
(GenBank) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00260  Glycine, serine and threonine metabolism
mau00311  Penicillin and cephalosporin biosynthesis
mau00330  Arginine and proline metabolism
mau00472  D-Arginine and D-ornithine metabolism
mau01100  Metabolic pathways
mau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_2018
   00330 Arginine and proline metabolism
    Micau_2018
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Micau_2018
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Micau_2018
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Micau_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox NAD_binding_8 Pyr_redox_2 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C GIDA Pyr_redox_3 FAD_oxidored HI0933_like Lycopene_cycl Thi4 ApbA Glu_dehyd_C 3HCDH_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADL45565
UniProt: D9T337
Position
2135196..2136149
Genome map
AA seq 317 aa AA seqDB search
MGVMTKADVVVVGGGVIGMTTALTLQRRGAHVTVLTAHDPADTVSTVAAAVWYPSHTEED
PRVLRWARDTHAELRRQAADGVPGVIDRPTRMWLRHRYAGPPWWADACGDLTAEPAEPPY
TALLRFTAPSVEMTPYLAWLRQRLEAGGGRIVGRALGTLAEAYEVAPVVVNATGLAAGRL
AADPAVYPARGHVLLVANPGLTVSVRDEDDPAGVTYVHPRRHDVVLGGTYEAGVGHTRPD
LEEAAAIRRRCVALVPHLADAPVLGERIGLRPARHGGPRVEVDATDGRLVHAYGHGGAGV
TLSWGCAAEVADLALGV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatgacgaaggcggacgtggtggtggtcggcggcggggtgatcgggatgacg
acggcgctcacgctccagcggcggggcgcacacgtcaccgtcctgaccgcccacgacccg
gccgacacggtgtcgacggtggccgccgcggtctggtacccgagccacaccgaggaggat
ccccgggtgctgcgctgggcccgggacacccacgccgagctgcgccgccaggcggccgac
ggggtgccgggagtgatcgaccggcccacccggatgtggttgcgccaccgctacgccgga
ccgccctggtgggccgacgcctgcggcgacctgacggccgagccggcggagccgccgtac
accgcgctgctgcggttcaccgccccgtcggtggagatgaccccgtacctcgcctggctc
cggcagcgcctggaggcgggcggcggccggatcgtcggccgcgcgctgggcacgctcgcc
gaggcgtacgaggtcgccccggtcgtggtgaacgcgaccggcctggccgccggccggctc
gccgccgacccggccgtgtacccggcgcgcgggcacgtcctgctggtggcgaacccgggc
ctgaccgtctcggtacgcgacgaggacgacccggcaggagtcacgtacgtgcatccgcgc
cgccacgacgtggtgctcggcggcacctacgaggccggggtgggacacacccgccccgac
ctggaggaggcggcggcgatccggcgccggtgcgtggcgctggtgccgcatctcgcggac
gcgccggtgctgggggagcggatcgggctgcggccggcacggcacggcggcccccgggtg
gaggtggacgcgacggacgggcggctggtgcacgcgtacgggcacggcggcgccggggtg
acgctgtcctggggctgcgccgccgaggtggccgacctggccctgggcgtctga

DBGET integrated database retrieval system