KEGG   Micromonospora aurantiaca: Micau_2580Help
Entry
Micau_2580        CDS       T01296                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00260  Glycine, serine and threonine metabolism
mau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01130  Biosynthesis of antibiotics
mau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_2580
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Micau_2580
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Micau_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL46118
UniProt: D9T7Z3
Position
complement(2937290..2938594)
Genome map
AA seq 434 aa AA seqDB search
MTATKFVLPESDIPTTWYNVVPDLPKGLPPMLHPGTREPITPADLAPLFASELIAQEFST
ERDVDIPGPVLDIYRQWRPSPLIRARRLERDLDTPARIYFKYEGVSPAGSHKPNTAVPQA
YYSKLDGVRRLTTETGAGQWGSSLSMACAYFDLECEVFMVRVSYDQKPYRRGLMETFGAS
VTASPSDRTEAGRAVLATDPDSPGSLGLAISEAVEAALHSGGAARYALGSVLNLVLMHQT
IIGQEALAQMGLAGDYPDVVVGAAGGGSNFAGLALPFLRRQLDGGPAVRFLAAEPASCPS
LTRGSYDYDFGDTAGLTPLAKMHTLGHDFRPPAIHAGGLRYHGMAPIVSALSEVDLIEAR
AVPQTACFEAGVRFARSEGIVPAPESSHAVRVAVDEALRCRETGEEKAILFSLSGHGHFD
MQAYIDYFAGKLTD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacgaagttcgtcctgcccgagagtgacatcccgacgacctggtacaacgtg
gttcccgacctgcccaaggggctgccgccgatgctgcaccccggcacccgggaaccgatc
accccggccgacctggcgccgctgttcgcctccgagctgatcgcgcaggagttctccacc
gaacgggacgtggacatccccggcccggtgctcgacatctaccggcagtggcggcccagc
ccgctgatccgggcccgccggctggaacgcgacctggacaccccggcgcggatctacttc
aagtacgagggggtcagcccggccggcagccacaagccgaacaccgccgtcccgcaggcg
tactacagcaagctcgacggggtgcggcggctgaccaccgagaccggcgccggccagtgg
ggcagctcgctgtcgatggcgtgcgcctacttcgacctcgagtgcgaggtcttcatggtg
cgggtcagctacgaccagaagccgtaccggcgcggcctgatggagacgttcggcgcctcg
gtcaccgccagccccagcgaccgtaccgaggccgggcgggcggtgctcgccaccgacccg
gactcccccggcagcctcggcctggccatctccgaggcggtggaggccgcgctgcacagc
ggcggcgccgcccggtacgcgctcggctcggtgctcaacctggtgctgatgcaccagacg
atcatcgggcaggaggcgctggcgcagatggggctggccggcgactaccccgacgtggtg
gtcggcgcggccggcggcggctccaacttcgcgggcctggccctgccgttcctgcgccgc
cagctcgacggcggtccggccgtccggttcctggccgccgagccggcgtcctgcccgtcg
ctgacccggggcagctacgactacgacttcggcgacaccgccgggctcaccccgctggca
aagatgcacacgctcggccacgacttccggccgcccgcgatccacgccggcgggctgcgc
taccacggcatggcgccgatcgtgagcgcgctgagcgaggtggacctgatcgaggcgcgg
gcggtgccgcagaccgcctgcttcgaggcgggcgtgcggttcgcccgcagcgaggggatc
gtgccggcgccggagtccagccacgcggtgcgggtcgccgtggacgaggcgctgcgctgc
cgggagaccggcgaggagaaggcgatcctgttctccctgtccgggcacggccacttcgac
atgcaggcgtacatcgactatttcgccggaaagctgacggactga

DBGET integrated database retrieval system