KEGG   Micromonospora aurantiaca: Micau_3782Help
Entry
Micau_3782        CDS       T01296                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00071  Fatty acid degradation
mau00280  Valine, leucine and isoleucine degradation
mau00281  Geraniol degradation
mau00310  Lysine degradation
mau00360  Phenylalanine metabolism
mau00362  Benzoate degradation
mau00380  Tryptophan metabolism
mau00410  beta-Alanine metabolism
mau00627  Aminobenzoate degradation
mau00640  Propanoate metabolism
mau00650  Butanoate metabolism
mau00903  Limonene and pinene degradation
mau00930  Caprolactam degradation
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01212  Fatty acid metabolism
Module
mau_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Micau_3782
   00650 Butanoate metabolism
    Micau_3782
  Lipid metabolism
   00071 Fatty acid degradation
    Micau_3782
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Micau_3782
   00310 Lysine degradation
    Micau_3782
   00360 Phenylalanine metabolism
    Micau_3782
   00380 Tryptophan metabolism
    Micau_3782
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Micau_3782
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Micau_3782
   00281 Geraniol degradation
    Micau_3782
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Micau_3782
   00627 Aminobenzoate degradation
    Micau_3782
   00930 Caprolactam degradation
    Micau_3782
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Micau_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADL47306
UniProt: D9T070
Position
4228256..4229005
Genome map
AA seq 249 aa AA seqDB search
MSKVELHNADGRWTLTLNDPDRRNAIDAEMRDALGDAIAEVAADRHARTLVVTGAGTAFC
AGADLPAMFGEPGRGVAEIRADLHRVYDSFLRVRALPIPTIAAVQGPAVGAGLNLALACD
TRIVGPKAKLIASFTKLGLHPGGGCTWFLTRALGPERALQLLLDGGSVDGPEAVRVGLAA
TLADDPLAAAHERAERWAALDPALARDIKTSVRTAETAGFAAALEFESWAQASSATGPAI
QEAVAAFRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtggaactgcacaacgcggacgggcgctggacgctcacgctgaacgacccg
gaccggcgcaacgccatcgacgcggagatgcgcgacgcgctcggcgacgcgatcgccgag
gtggccgccgaccggcacgcccgcacgctcgtggtcaccggcgcgggcacggcgttctgc
gccggcgccgacctgcccgccatgttcggcgaaccaggccgcggcgtcgcggagatccgc
gccgacctgcaccgcgtctacgacagcttcctgcgggtacgggcgctgccgatcccgacg
atcgccgcggtgcagggaccggcggtgggcgccgggctgaacctggcgctcgcgtgcgac
acccggatcgtcgggccgaaggcgaagctgatcgcctcgttcacgaagctcggcctgcac
cccggcgggggctgcacctggttcctcacccgggcgctcggcccggaacgcgccctgcaa
ctgctgctcgacggcgggagcgtggacggccccgaggcggtacgcgtcgggctcgccgcg
acgctcgccgacgacccgctggcggccgcgcacgagcgcgccgaacggtgggcggcgctg
gacccggcgctggcccgggacatcaagacgtcggtgcgcaccgcggagacggccggtttc
gccgccgcgctggagttcgagtcgtgggcccaggcgtcctcggcgaccgggccggcgatc
caggaggcggtggccgcgttccgcaggtga

DBGET integrated database retrieval system