KEGG   Micromonospora aurantiaca: Micau_3983
Entry
Micau_3983        CDS       T01296                                 

Definition
(GenBank) protein of unknown function DUF1486
  KO
K15945  C-1 hydroxylase
Organism
mau  Micromonospora aurantiaca
Pathway
mau01057  Biosynthesis of type II polyketide products
mau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Micau_3983
SSDB
Motif
Pfam: SnoaL SnoaL_2 DUF4440
Other DBs
NCBI-ProteinID: ADL47506
UniProt: D9T280
Position
complement(4524778..4525197)
AA seq 139 aa
MSPLENKNRCLQMVAAWNRADVSGVTEHWAPDVTHYNLDGEPHDTELVLTAMRGSLVSFS
DLRLEVKSILAEGDRVMLRLTATATHSGEFAGIPATGRKVTWHYLEELRFNEEGKVVEHW
DIFDFAPLFRELGHPAPAL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcgccgctggagaacaagaatcgctgcctgcagatggtcgccgcctggaaccgggca
gacgtgtcgggggtgactgagcactgggcgcccgacgtcacgcattacaacctggacggc
gagccgcacgacactgaactcgtcctgacggcgatgcgtggctcgctggtgtccttctca
gacctgcgactcgaagtgaagagcatcctcgcggaaggcgaccgggtgatgctccggttg
accgcgaccgccacgcacagcggtgagttcgccgggataccggcgaccgggcggaaggtc
acctggcactacctcgaggagctgcgcttcaacgaggagggcaaggtcgtcgagcactgg
gacatattcgacttcgccccgctgttccgggaactcggccacccggcaccggcgctctga

DBGET integrated database retrieval system