KEGG   Micromonospora aurantiaca: Micau_4335Help
Entry
Micau_4335        CDS       T01296                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00010  Glycolysis / Gluconeogenesis
mau00051  Fructose and mannose metabolism
mau00562  Inositol phosphate metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
mau01230  Biosynthesis of amino acids
Module
mau_M00002  Glycolysis, core module involving three-carbon compounds
mau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_4335
   00051 Fructose and mannose metabolism
    Micau_4335
   00562 Inositol phosphate metabolism
    Micau_4335
Enzymes [BR:mau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Micau_4335
Exosome [BR:mau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Micau_4335
  Exosomal proteins of bladder cancer cells
   Micau_4335
  Exosomal proteins of melanoma cells
   Micau_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL47848
UniProt: D9T538
Position
complement(4910538..4911329)
Genome map
AA seq 263 aa AA seqDB search
MASTTRRPLMAGNWKMNLNHLEANLLVQKLAASLNEKQLTDVECVVLPPFTDLRTVQTAV
DGDKLLIGYGAQDLSPHPSGAYTGDIAGPMLAKLGCGYVVVGHSERRQYHNEDDALVNAK
VSAALANGLTPILCIGEGLEVREQSGQVRHCCDQLDGALKGLTAEQVTKVVVAYEPVWAI
GTGKTATPDDAQEVCGAVRKRIAETYDEGTAEQVRILYGGSVKASNVAAIMAQPDVDGAL
VGGASLDAEEFAQICRFPEHITR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacgacccgccggccgctgatggccggcaactggaagatgaacctgaaccac
ctcgaggccaacctgctggtgcagaagctggccgcgagcctgaacgagaagcagctcacc
gacgtcgagtgcgtggtgctgccgcccttcaccgacctgcgtaccgtgcagaccgccgtg
gacggcgacaagctgctgatcggctacggcgcgcaggacctgtcgccgcacccgtccggc
gcgtacaccggtgacatcgccgggccgatgctcgccaagctgggctgcggctacgtggtg
gtcgggcactccgagcggcggcagtaccacaacgaggacgacgcgctcgtcaacgcgaag
gtgtcggcggcgctggcgaacgggctcaccccgatcctctgcatcggtgagggcctggag
gtccgggagcagtcgggtcaggtgcggcactgctgcgaccagctcgacggcgcgctgaag
gggctcaccgccgagcaggtcaccaaggtcgtcgtggcgtacgagccggtctgggcgatc
ggcaccggcaagacggcgaccccggacgacgcccaggaggtctgcggcgcggtgcgcaag
cgcatcgccgagacctacgacgagggcaccgccgagcaggtccggatcctgtacggcggg
tcggtcaaggcgtcgaacgtcgccgcgatcatggcgcagccggacgtggacggggctctg
gtcgggggcgccagcctggacgcggaggagttcgcgcagatctgccggttcccggagcac
atcacccgctga

DBGET integrated database retrieval system