KEGG   Micromonospora aurantiaca: Micau_4422Help
Entry
Micau_4422        CDS       T01296                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00260  Glycine, serine and threonine metabolism
mau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01130  Biosynthesis of antibiotics
mau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_4422
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Micau_4422
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Micau_4422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA KDGP_aldolase His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADL47935
UniProt: D9T630
Position
complement(5015665..5016468)
Genome map
AA seq 267 aa AA seqDB search
MSRIGVAFDKARADGRAVLVGCMPAGFPTVEGSIAAMKAMVEAGVDVIEVEIPYSDPVMD
GPVIQKASDIALAGGVRVADALRVVEAVAATGASVVTMTYWNPIEQYGVDAFARDMAAAG
GTGLITPDLIPDEAAEWLAASDAHGLDRTFLVSPSSTDARLRMTVEHCRGFVYATAIMGV
TGARAQTSEAAPILVSRLREVTDIPVGVGLGVGTGAQAATVAGYADAVIVGSALVRCVLD
APDQAAGLTALRKLSAELAEGVRNPAR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcatcggggtcgccttcgacaaggcgcgggcggacgggcgggcggtgctggtc
ggctgcatgccggcgggcttcccgaccgtcgagggcagcatcgccgccatgaaggccatg
gtcgaggcgggcgtggacgtcatcgaggtggagatcccgtactccgacccggtgatggac
ggcccggtcatccagaaggcgagcgacatcgcgctcgccggcggtgtccgcgtcgccgac
gcgctgcgcgtcgtcgaggcggtcgcggcgaccggggcgagcgtggtcaccatgacctac
tggaacccgatcgagcagtacggcgtggacgcgttcgcccgcgacatggccgccgccggc
ggcaccggcctgatcacgccggacctgatcccggacgaggccgccgagtggctggccgcc
tccgacgcgcacggcctggaccgcacgttcctggtctcgccgtcctcgaccgacgcgcgg
ctgcggatgacagtcgagcactgccgcggcttcgtctacgccaccgcgatcatgggcgtc
accggcgcccgcgcgcagacctccgaggcggcaccgatcctggtctcccggctgcgcgag
gtcaccgacatcccggtcggcgtcgggctgggcgtcggcaccggcgcgcaggccgccaca
gtcgccgggtacgccgacgcggtgatcgtgggcagcgcgctggtccgctgcgtgctggac
gctccggaccaggctgccggcctgaccgcgctgcgcaagctcagcgccgaactcgccgag
ggcgtccgcaaccccgctcgctga

DBGET integrated database retrieval system