KEGG   Micromonospora aurantiaca: Micau_4603Help
Entry
Micau_4603        CDS       T01296                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00020  Citrate cycle (TCA cycle)
mau00310  Lysine degradation
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
Module
mau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Micau_4603
  Amino acid metabolism
   00310 Lysine degradation
    Micau_4603
Enzymes [BR:mau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Micau_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADL48115
UniProt: D9T7C3
Position
5208626..5210488
Genome map
AA seq 620 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIV
VGEDETAEVGSELAVIAGEGEDAGAAPTEKAEPATEPTAAAEGTGPEPEQAQEAEEAAAE
PGAEAEQPAVEEPAEPAAPSGEGTPVTMPALGESVTEGTVTRWLKQVGETVEVDEPLLEV
STDKVDTEIPSPVAGTLQEIKVAEDETADVGAVLAIVGVAGAAPAKAEPKPEPKPEPKAE
AKPEPKPEPKVEEPTPGASYNEPAAEAEQAAQPAKAEQAAQPAEQAAQPAAPAAAQRPSV
PSEYGEDAAGYVTPLVRKLAAEHGVDLGSIKGTGVGGRIRKQDVLEAAEKAKAAKPAPAA
AAAPSAPAPAKPAAKPEPSAKRGTTEKLPRIRSIIAKRLQQSLHETAQLTTVVEVDVTKV
AKLRARAKDSFQAKHGVKLSFLPFFAVAAIEALQTYPIIQASMDLDGGTITYPGAEHLGI
AVDTERGLLTPVIHNAGDLNMGGLAKRIADLAERTRANKITPDEMAGATFTLTNTGSRGA
LFDTPIVPSPQSAMLGTGAVVKRPVVVNDAELGEVVAIRSMVYLALSYDHRLIDGADAAR
FLTAVKERLEGGNFEAELGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtcccccgcggcgggcgtgctgagccggatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcggtcatcgccggcgagggc
gaggacgcgggcgcggctcccacggagaaggccgagccggccaccgagccgacggccgcc
gccgagggcaccggccccgagccggagcaggcccaggaggccgaggaggccgccgccgag
ccgggcgccgaggccgagcagccggccgtcgaggagccggccgagcccgccgcgccgtcg
ggcgagggcacgccggtgaccatgccggccctgggcgagagcgtcaccgagggtactgtc
acccgctggctcaagcaggtcggcgagaccgtcgaggtggacgagccgctgctggaggtc
tccaccgacaaggtcgacaccgagatcccgtcgccggtcgccggcacgctgcaggagatc
aaggtcgccgaggacgagaccgccgacgtcggcgccgtgctggcgatcgtcggggttgcc
ggcgccgcgcccgcgaaggcggagccgaagcccgagcccaagccggagcccaaggccgag
gcgaagcccgaaccgaagccggagccgaaggtcgaggagcccacgccgggcgcgtcctac
aacgagccggccgccgaggcggagcaggccgcgcagccggccaaggccgagcaggcggcc
cagccggccgagcaggcggcccagccggccgcgccggccgccgcgcagcgcccgagcgtt
ccgtccgagtacggcgaggacgccgccgggtacgtgacgccgctggtgcgcaagctcgcc
gccgagcacggcgtggacctgggctcgatcaagggcaccggcgtgggtggccgcatccgc
aagcaggacgtgctggaggcggccgagaaggcgaaggccgccaagcccgcgccggccgcc
gccgctgccccgtccgcacccgccccggccaagccggccgccaagccggagccgagcgcc
aagcggggcaccacggagaagctgccgcggatccgttcaatcatcgccaagcgtctccag
cagtcgctgcacgagacggcgcagctgaccaccgtcgtcgaggtcgacgtcaccaaggtc
gccaagctgcgggcgcgggccaaggactcgttccaggccaagcacggcgtgaagctgtcc
ttcctgccgttcttcgcggtggccgcgatcgaggcgctccagacgtacccgatcatccag
gccagcatggacctggacggcgggacgatcacctacccgggcgccgagcacctgggcatc
gcggtggacaccgagcgcgggctgctcacgccggtcatccacaacgccggtgacctgaac
atgggtggcctggccaagcggatcgccgacctggccgagcgcacccgggccaacaagatc
accccggacgagatggccggggcgacgttcacgctcaccaacaccggcagccggggcgcg
ctgttcgacaccccgatcgtgccgtcgccgcagtcggcgatgctcggcacgggtgccgtg
gtgaagcgcccggtcgtggtgaacgacgcggagctgggcgaggtcgtggcgatccgctcg
atggtctacctggctctgtcgtacgaccaccggctgatcgacggcgccgacgcggcccgc
ttcctcaccgcggtgaaggagcggctggagggcggcaacttcgaggccgagctgggtctg
tag

DBGET integrated database retrieval system