KEGG   Micromonospora aurantiaca: Micau_5398Help
Entry
Micau_5398        CDS       T01296                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00020  Citrate cycle (TCA cycle)
mau00640  Propanoate metabolism
mau00660  C5-Branched dibasic acid metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
Module
mau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Micau_5398
   00640 Propanoate metabolism
    Micau_5398
   00660 C5-Branched dibasic acid metabolism
    Micau_5398
Enzymes [BR:mau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Micau_5398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADL48904
UniProt: D9TE21
Position
complement(6055876..6057054)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LAEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAAETPERVVKAPIDANTGVDEAKAREIVTAAGFPAEIADQVVEVAVKLWQAF
VAEDATLVEVNPLATTKDGKLLLLDAKVTLDENAGFRHPDHEALVDQASVDPLEQAAKAK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAEVMANGLE
IVLSDPSVKSVFVNVFGGITACDAVANGIVQALALLEQRGEKATKPLVVRLDGNNAEAGR
AILDGAANPLIQRVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggggcgggacctgttcgagcggcacggcttgcccgtgctc
gccggcggcgtcgccactaccccggaggaggcccgcgcgatcgccgaacgcctcggcggc
cgggtggtcgtcaaggcgcaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctggccgagggcgcggaggagacggtggcccgggccaccgacatcctcggcatggacatc
aagggtcacaccgtccacaaggtcatgatcaccgtgaccgcggacgtggccgaggagtac
tacttctcgtacctgctcgaccgggcgaaccgcaccttcctctgcatcgccagcgtggcc
ggcggtatggacatcgagcaggtcgcggccgagaccccggagcgggtcgtgaaggcgccg
atcgacgccaacaccggcgtggacgaggccaaggcgcgcgagatcgtcaccgcggccggc
ttcccggccgagatcgccgaccaggtggtcgaggtcgcggtcaagctgtggcaggcgttc
gtggccgaggacgccacgctcgtcgaggtgaacccgctggccacgaccaaggacggcaag
ctgctgctcctggacgccaaggtcaccctggacgagaacgccgggttccggcacccggac
cacgaggccctggtcgaccaggcgtcggtggacccgctggagcaggccgcgaaggccaag
gacctcaactacgtcaagctcgacggcgaggtcggcatcatcggtaacggcgcgggcctg
gtcatgtccacgctcgacgtggtcgcgtacgcgggcgagcggcacggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcgagcgccgaggtgatggcgaacggcctggag
atcgtcctgtccgacccgtcggtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgtgacgcggtcgccaacggcatcgtgcaggcgctggcgctgctggagcagcgcggc
gagaaggccaccaagccgctcgtcgtgcgcctcgacggcaacaacgccgaggccggccgg
gcgatcctcgacggcgcggcgaacccgctgatccagcgggtcgacaccatggacggcgcg
gccgagcgggccgccgagctggcagctgcgggggtctga

DBGET integrated database retrieval system