KEGG   Microbacterium aurum: BOH66_03805Help
Entry
BOH66_03805       CDS       T04977                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
maur  Microbacterium aurum
Pathway
maur00770  Pantothenate and CoA biosynthesis
maur01100  Metabolic pathways
Module
maur_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BOH66_03805
Enzymes [BR:maur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BOH66_03805
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BOH66_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: APZ33493
UniProt: A0A1P8U5Y1
Position
complement(758682..759893)
Genome map
AA seq 403 aa AA seqDB search
MFVVVGVTGGIAAYKTVQVVRTLVTSGHEVHVVPTADALRFVGTATWEAVSRNSVTTSVH
EDVAQVRHVALGTSADLVIVAPATANTLARMAAGIADDLLGVTLLATTAPVVVAPAMHTA
MWEHAATQQNIQTLRGRGVHVVGPADGPLTGGDSGPGRMVEPDEIVAAALAVAAGTAAHD
DLAGRRVAVSTGGTREPIDPVRFLGNRSSGRQGAELALAAADRGADVTLVAAHVDDGVLD
AATRHPHITLVHASTAADLEAAMTDAAARADIVAMVAAVADYRAAEVAAHKLRKEDGPLQ
LDLVENPDILAGLVAARRPGQTIVGFAAETASDDAELLERGRRKRARKGVDLLAVNRVSW
DEGFEAAENRVLLLDARGEVVADAAGTKRAVADAVWDAVAAAR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgtcgtgggtgtgacgggcggcatcgccgcgtacaagacggtgcaggtggtg
cgcaccctcgtgacgagcggtcacgaggtgcacgtcgtacccacggcggatgcgctgcgg
ttcgtcgggacggccacgtgggaggccgtcagcaggaattctgtcacgacgagcgtgcac
gaggacgtcgcgcaggtgcgccacgtggcgctcgggacgtccgccgacctcgtgatcgtc
gcgccggcgaccgcgaacaccctcgcccgcatggcggcgggcatcgccgacgacctgctc
ggggtgacactcctcgccaccacggcgccggtcgtcgtcgcgcccgcgatgcacaccgcg
atgtgggagcacgccgcgacgcagcagaacatccagacactgcgcgggcgcggcgtgcac
gtcgtcggccccgccgacggtccgctcaccggcggcgacagcggcccgggacgcatggtc
gagcccgacgagatcgtcgcggcagcgctcgcagtcgccgccggcaccgccgcgcacgac
gacctcgccggccgacgcgtggccgtgtcgacgggcggcacgcgtgagcccatcgacccg
gtgcggttcctcggcaaccgctccagcggacggcagggcgccgagctcgcgctggcggcg
gccgaccggggcgccgacgtgacgctcgtcgcggcccacgtggacgacggcgtgctcgat
gcggccacgcggcatccgcacatcaccctcgtgcacgcgtcgaccgccgcggacctcgag
gccgcgatgacggatgccgcggcccgcgccgatatcgtcgcgatggtcgccgccgtcgcc
gactaccgggccgccgaggtcgccgcgcacaagctgcgcaaagaggacggtcccctgcag
ctcgacctcgtggagaaccccgacatcctggcggggctcgtcgccgcccgccgacccggc
cagacgatcgtcgggttcgccgccgagaccgcgtcggacgacgccgagctgctcgagcgc
ggccgccgcaaacgcgcccgcaaaggcgtcgacctgctggccgtcaaccgcgtctcgtgg
gacgagggcttcgaggcggccgagaaccgcgtgctgctgctcgacgcccgaggtgaggtc
gtggcggatgccgcgggcaccaaacgcgccgtcgccgatgccgtctgggacgcggtcgcc
gcggcgcgctga

DBGET integrated database retrieval system