KEGG   Microbacterium aurum: BOH66_12465Help
Entry
BOH66_12465       CDS       T04977                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
maur  Microbacterium aurum
Pathway
maur00220  Arginine biosynthesis
maur00330  Arginine and proline metabolism
maur01100  Metabolic pathways
maur01110  Biosynthesis of secondary metabolites
maur01130  Biosynthesis of antibiotics
maur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BOH66_12465
   00330 Arginine and proline metabolism
    BOH66_12465
Enzymes [BR:maur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BOH66_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF2374 UPF0489
Motif
Other DBs
NCBI-ProteinID: APZ34964
UniProt: A0A1P8UA23
Position
2538765..2539577
Genome map
AA seq 270 aa AA seqDB search
MTRFLVVPQWQGSPAARAMHLVDGAEAIAGDLPRASTARVEVPASAGEALGTGIRRYSAL
ARIADAVTDALGQAAKPAIVVGGDCGVAVPAIAHAAEQHPDLAVVWFDAHADLNSPATSP
SGAFAGMALRAVFTDLPLPGSGAVAADRVVLAGAREFDPAEQAFVDEVGLRVLSVDDLAD
PGAPAEAVAATRASAVYIHVDLDVLDPAVITGVGLPVPFGLTLDQLTSAIAAVRARRPLV
GASIAGFAPADPAAAVDDLGTILRVVGALA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacccgattcctcgtggtcccgcagtggcaggggtctcccgccgcccgggcgatgcac
ctcgtcgacggtgccgaggcgatcgccggcgaccttccccgcgcctccaccgcacgcgtc
gaggtgcccgcctccgccggcgaggcgctgggcaccggcatccgccggtacagtgccctc
gcccgcatcgccgacgccgtcacggacgccctcggccaggcggccaagcccgcgatcgtc
gtcggcggcgactgcggcgtcgccgtccccgccatcgcgcatgccgccgagcagcatccc
gacctcgccgtggtgtggttcgacgcccatgccgacctcaactcccccgccacctcgccg
tccggcgcgttcgcggggatggcgctgcgcgcggtgttcaccgaccttccgctgcccggg
agcggagccgtcgccgccgaccgcgtggtcctcgccggcgcccgcgagttcgaccctgcc
gagcaggccttcgtcgacgaggtgggcctgcgggtgctgtcggtcgacgacctcgccgac
cccggcgcccccgccgaggcggtcgccgcgacgcgggcctccgcggtgtacatccacgtc
gacctcgacgtgctcgacccggccgtcatcaccggggtgggcctgcccgtgcccttcggc
ctcacactcgaccagctgacgagcgccatcgccgccgtccgcgcccggcggccgctcgtc
ggcgcctcgatcgccggttttgcccccgccgaccccgccgccgcggtcgacgacctcggc
accatcctccgcgtcgtcggggcgctcgcgtga

DBGET integrated database retrieval system