KEGG   Microbacterium aurum: BOH66_13540Help
Entry
BOH66_13540       CDS       T04977                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
maur  Microbacterium aurum
Pathway
maur00020  Citrate cycle (TCA cycle)
maur00640  Propanoate metabolism
maur00660  C5-Branched dibasic acid metabolism
maur01100  Metabolic pathways
maur01110  Biosynthesis of secondary metabolites
maur01120  Microbial metabolism in diverse environments
maur01130  Biosynthesis of antibiotics
maur01200  Carbon metabolism
Module
maur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOH66_13540
   00640 Propanoate metabolism
    BOH66_13540
   00660 C5-Branched dibasic acid metabolism
    BOH66_13540
Enzymes [BR:maur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BOH66_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: APZ35159
UniProt: A0A1P8UAL4
Position
complement(2780309..2781211)
Genome map
AA seq 300 aa AA seqDB search
MSIYLNKDSKVIVQGITGGEGTKHTALMLKAGTNVVGGVNARKAGTTVSHTDAAGNAVEL
PVFGSVAEAIEATGADVSIAFVPPAFTKDAMVEAIDTEIPLLVVITEGVPVGDTAEAWAY
AKSKGNKTRIIGPNCPGIITPGEALVGITPANITGKGPIGLVSKSGTLTYQMMFELRDLG
FSTAIGIGGDPIIGTTHIDALEAFEADPETKAIVMIGEIGGDAEERAAEYIKAHVTKPVV
GYVAGFTAPEGKTMGHAGAIVSGSAGTAQAKKEALEAAGVKVGKTPSETAALMREIIETL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctacctcaacaaggactccaaggtcatcgtccagggcatcaccggcggcgag
ggcaccaagcacaccgcgctcatgctgaaggcgggcaccaacgtcgtcggcggcgtcaac
gcgcgcaaggccggcacgacggtctcacacacggatgccgcgggcaacgcggtcgagctc
ccggtcttcggctccgtcgccgaggccatcgaggcgaccggcgccgacgtgtcgatcgcg
ttcgtgccgccggcgttcacgaaggacgcgatggtcgaggccatcgacaccgagatcccc
ctcctcgtcgtcatcaccgagggcgtgcccgtcggcgacaccgccgaggcgtgggcgtac
gcgaagagcaagggcaacaagacccgcatcatcggaccgaactgccccggcatcatcacc
cccggtgaggcgctcgtcggcatcacgcccgcgaacatcacgggcaaggggccgatcggc
ctcgtctcgaagtcgggcacgctgacctaccagatgatgttcgagctgcgcgacctgggc
ttctcgaccgcgatcggcatcggcggcgacccgatcatcggcacgacgcacatcgacgcc
ctcgaggcgttcgaggccgaccccgagacgaaggcgatcgtcatgatcggcgagatcggc
ggcgacgccgaggagcgcgcggccgagtacatcaaggcgcacgtgaccaagccggtcgtc
ggctacgtcgccgggttcaccgctcccgaaggcaagacgatgggccacgccggcgcgatc
gtctcgggctcggcgggcaccgcgcaggcgaagaaggaggccctcgaggccgctggcgtc
aaggtcgggaagaccccgtccgagaccgccgccctgatgcgcgagatcatcgagacgctg
taa

DBGET integrated database retrieval system