KEGG   Mycolicibacterium aurum: NCTC10437_03966
Entry
NCTC10437_03966   CDS       T06794                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mauu  Mycolicibacterium aurum
Pathway
mauu00903  Limonene and pinene degradation
mauu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mauu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCTC10437_03966
Enzymes [BR:mauu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     NCTC10437_03966
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: VEG56964
UniProt: A0A3S4S0I2
Position
1:4225382..4226218
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRAHAVRMAQEGADIIAVDICKQIDSVQIPLSTPEDLAETA
DLVKNAGARVYTAEVDTRDFDALKAAVDAGVEEFGRLDIIVANAGIGNGGQTLDKTSEGD
WTDMIDVNLGGVWKTVKAGVPHILAGERGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAKNIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPDDMKVVGEFMHTLP
IGWVEPEDIANAVLFLASDEARFITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggacgtgtagaaggcaaggtcgctttcatcaccggtgcggcacgcggacagggc
cgcgcccacgcggtgcgcatggcccaagagggcgccgacatcatcgccgtcgacatctgt
aagcagatcgacagcgtgcagattccgctgtccacgccggaggacctggccgaaaccgcg
gatctggtcaagaacgccggcgcgcgcgtctacacagccgaggtcgacacccgcgacttc
gacgcgctcaaggccgccgtcgacgccggcgtcgaagagttcggccggctcgacatcatc
gtggccaatgccgggatcggcaacggtggccagacgctggacaagaccagcgagggcgac
tggaccgacatgatcgacgtcaacctcggtggggtgtggaagaccgtcaaagccggtgtg
ccgcacatcctcgccggcgagcgaggcggatcgatcatcctgaccagctcggtgggcggc
ctcaaggcctacccgcacaccggtcactacgtcgcggccaaacacggtgtggtggggctg
atgcgcacgtttgccgtcgagctgggcgcgaagaacatccgggtcaactcggtgcacccg
acgaacgtgaacacgccgctgttcatgaacgagggcaccatgaagctgttccggcccgat
ctggagaacccgggccccgacgacatgaaggtcgtcggcgagttcatgcacacgctgccc
atcggctgggtggagcccgaggacatcgccaacgcggtgctgttcctcgcctccgacgag
gcgcgtttcatcaccggcgtcacactgccggtcgacggcggcagctgcctcaagtag

DBGET integrated database retrieval system