KEGG   Mycobacterium avium 104: MAV_0896
Entry
MAV_0896          CDS       T00433                                 

Definition
(GenBank) carveol dehydrogenase ((+)-trans-carveol dehydrogenase)
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mav  Mycobacterium avium 104
Pathway
mav00903  Limonene and pinene degradation
mav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAV_0896
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MAV_0896
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: ABK65819
UniProt: A0A0H2ZTN5
Structure
PDB: 
3UVE

Position
complement(843426..844274)
AA seq 282 aa
MTGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDL
AETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKT
SEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHG
VVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMF
HTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaccggacgtgttgagggcaaagtcgctttcgtcaccggggcggcacgcggtcagggc
cgcagccacgcggtgaggttggcccaggagggcgccgacatcatcgccgtcgacatctgc
aagcccatccgggcgggcgtggtggacaccgccatcccggcctccacgcccgaggacctg
gccgagaccgccgatctggtcaaggggcacaaccgcagaatcgtcaccgccgaggtcgac
gtgcgcgactacgacgcgctcaaagccgcggtcgacagcggcgtcgagcagctgggccgg
ctggacatcatcgtggccaacgccggaatcggcaacggcggcgacactttggacaagacc
agcgaagaagactggaccgagatgatcgacatcaacctggccggggtgtggaaaaccgtg
aaagccggtgtgccgcatatgatcgccggcggccgcggcggatccatcatcctgaccagc
tcggtcggcgggctcaaggcctacccgcacaccggccactacgtcgcggccaagcacggc
gtggtcgggctgatgcgcgccttcggagtcgagttgggacagcacatgattcgcgtcaat
tcggtacacccgacgcacgtcaagaccccgatgctgcacaacgagggcaccttcaagatg
ttccgtccggatctggagaacccgggtcccgacgacatggcgccgatctgccagatgttc
cacacgctgcccatcccgtgggtcgagccgatcgacatcagcaacgcggtgctgttcttc
gcctcggacgaagcccgctacatcaccggcgtgaccctgcccatcgatgcgggtagctgc
ctgaaatag

DBGET integrated database retrieval system