KEGG   Mycobacterium avium 104: MAV_2340Help
Entry
MAV_2340          CDS       T00433                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
mav  Mycobacterium avium 104
Brite
KEGG Orthology (KO) [BR:mav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mav03036]
    MAV_2340 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mav04812]
    MAV_2340 (ftsZ)
   02048 Prokaryotic defense system [BR:mav02048]
    MAV_2340 (ftsZ)
Chromosome and associated proteins [BR:mav03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    MAV_2340 (ftsZ)
Cytoskeleton proteins [BR:mav04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   MAV_2340 (ftsZ)
Prokaryotic defense system [BR:mav02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    MAV_2340 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABK67480
UniProt: A0A0H2ZYL8
Position
2345899..2347059
Genome map
AA seq 386 aa AA seqDB search
MTPPHNYLAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGR
DSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARK
LGALTVGVVTRPFSFEGKRRSNQAEAGINALRESCDTLIVIPNDRLLQMGDAAVSLMDAF
RSADEVLLNGVQGITDLITTPGLINVDFADVKGIMSGAGTALMGIGSARGEGRSLKAAEI
AINSPLLEASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHQDANIIFGTVIDDSLG
DEVRVTVIAAGFDAAGPGRKPVIGGSADKGEKTGGAHRIESAKAGKLTSTLFEPVDAVSV
PIHTNGSTLNIGGEDDDVDVPPFMRR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacccccccgcacaactacctggccgtcatcaaggtcgtgggtatcggtggcggcggc
gtcaacgccgtcaaccggatgatcgaacagggactcaagggcgtggagttcatcgcgatc
aacaccgacgcgcaagcgctgttgatgagcgatgccgacgtcaaactcgacgtcgggcgc
gactccacccgtggactgggcgccggcgcggaccccgaggtcggccgcaaggccgccgag
gacgccaaggacgagatcgaggagctgctgcgcggcgccgacatggtgttcgtcaccgcc
ggcgagggcggcggcaccgggaccggcggggcgcccgtcgtcgccagcatcgcgcgcaag
ctcggcgctttgaccgtgggcgtggtcacccggccgttctcgttcgagggcaagcggcgc
agcaaccaggccgaggcgggcatcaacgcgctgcgggagagctgcgacaccctgatcgtc
atccccaacgaccggctgctgcagatgggcgacgcggccgtgtcactgatggacgccttc
cgcagcgccgacgaggtgctgctcaacggtgtgcagggcatcaccgacctgatcaccacg
ccggggctgatcaacgtcgacttcgccgacgtcaagggcatcatgtccggcgcgggcacc
gcgctgatgggcatcggctcggcccgcggcgagggccgctcgctcaaggccgccgagatc
gccatcaactcgccgctgctggaggcctcgatggagggtgcgcagggcgtgctgatgtcc
atcgccggcggcagcgacctggggctgttcgagatcaacgaggcggcctcgctggtgcag
gacgccgcccaccaggacgccaacatcatcttcggcaccgtgatcgacgattcgctgggc
gacgaggtgcgggtcaccgtcatcgcggccggcttcgacgccgccgggccggggcgcaag
ccggtgatcggcggcagcgccgacaagggggagaagaccggcggcgcgcaccggatcgag
tcggccaaggcgggcaagctcacctcaacgttgttcgagccggtcgacgcggtcagcgtg
ccgatccacaccaacggctcgacgctgaatatcggcggcgaggacgacgacgtggatgtg
ccgcctttcatgcgccgctga

DBGET integrated database retrieval system