KEGG   Mycobacterium avium 104: MAV_2584Help
Entry
MAV_2584          CDS       T00433                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mav  Mycobacterium avium 104
Pathway
mav00071  Fatty acid degradation
mav00072  Synthesis and degradation of ketone bodies
mav00280  Valine, leucine and isoleucine degradation
mav00310  Lysine degradation
mav00362  Benzoate degradation
mav00380  Tryptophan metabolism
mav00620  Pyruvate metabolism
mav00630  Glyoxylate and dicarboxylate metabolism
mav00640  Propanoate metabolism
mav00650  Butanoate metabolism
mav00900  Terpenoid backbone biosynthesis
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
mav01212  Fatty acid metabolism
mav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAV_2584
   00630 Glyoxylate and dicarboxylate metabolism
    MAV_2584
   00640 Propanoate metabolism
    MAV_2584
   00650 Butanoate metabolism
    MAV_2584
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAV_2584
   00072 Synthesis and degradation of ketone bodies
    MAV_2584
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAV_2584
   00310 Lysine degradation
    MAV_2584
   00380 Tryptophan metabolism
    MAV_2584
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAV_2584
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAV_2584
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MAV_2584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mav04147]
    MAV_2584
Enzymes [BR:mav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAV_2584
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAV_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABK66993
UniProt: A0A0H2ZWP2
Position
complement(2620275..2621462)
Genome map
AA seq 395 aa AA seqDB search
MATTTSRAAIVAAARTPIGTARKGTLANMPAIELAKPVVQAVVERSGLDAADFDDLVLAE
SMQGGGDSARYIAVALGMLDIPGLAVNRQCASSLSAIAVGAGQIASGMSRAILAGGMESL
STGPIMQKRKLFTAGKSPEDYAQWFPESHPPTAEAPAMDMSITVAHNCNLQYGITREDQD
NWALRSHQRAIRAIDTGAFTDEIIPLQVPQADGSVITFAEDEHPRRGSSMESLAGLKVLH
PEIEGFTVTAGNSSGINDAAAVVALASPDTQQDVLASVLSWTQVGLDPTRTGSGPIKAIP
KALELAGRKLEDVALFEINEAFAAQAVACARELGLDEEIVNVYGSGISLGHPIAATGARM
VTSAIYELRRRGGGIGVLSMCAGGGMGAAMVIEVA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccacgtcccgcgcagcgatcgtggccgctgcccgcacaccgatcggaacg
gcgcgcaagggcacgctggccaacatgccggcgatcgagctcgccaaacccgtcgtgcag
gccgtcgtcgaacgctccggactggacgcggcggacttcgacgacctggtgctggccgag
agcatgcagggcggcggcgacagtgcccgctacatcgcggtggccctcggcatgctcgac
attcccgggctcgccgtcaaccgccagtgcgcatcgagtctttcggccatcgccgtgggc
gccgggcagatcgcgtccgggatgagccgcgccatcctggccggcggtatggagtcgctg
tcgaccggcccaatcatgcagaagcgcaagctcttcaccgcaggcaagtcgcccgaggac
tacgcgcagtggttccccgagtcgcatccgccgactgcggaagcgcccgccatggacatg
tccatcaccgtcgcgcacaactgcaaccttcagtacgggatcacccgcgaggaccaggac
aattgggcgctgcgcagccatcagcgcgcgatcagggccatcgacaccggggcgttcacc
gacgagatcatcccgctccaggtgccccaggccgacggcagcgtgattaccttcgccgag
gacgagcatccacggcgcgggagttcgatggagtcgcttgccgggctgaaggtgctgcat
cctgagatcgaaggcttcaccgtgacggcaggaaactcctccgggatcaacgatgccgcg
gcagtggtcgcgctggccagcccggacacccagcaggatgtgctggcaagcgtgctgtcc
tggacgcaggtcggactggacccgacgcggaccggcagcgggccgatcaaagctatcccg
aaggcgctcgagttggcgggccgcaagctcgaggatgtcgcactattcgaaatcaacgag
gcgttcgccgctcaggcggtggcgtgtgcgcgcgaactcggtctcgacgaggagatcgtc
aacgtctacggctcgggcatcagcctgggccacccgatcgccgcaaccggcgcccgcatg
gtcacctcggcgatctacgaattgcgcaggcgcggtgggggtatcggcgtgctgtcaatg
tgcgccggcggtggtatgggtgccgcgatggtcattgaggtggcctga

DBGET integrated database retrieval system