KEGG   Mycobacterium avium 104: MAV_2796Help
Entry
MAV_2796          CDS       T00433                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
mav  Mycobacterium avium 104
Pathway
mav00260  Glycine, serine and threonine metabolism
mav00330  Arginine and proline metabolism
mav00472  D-Arginine and D-ornithine metabolism
mav01100  Metabolic pathways
mav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAV_2796
   00330 Arginine and proline metabolism
    MAV_2796
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    MAV_2796
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    MAV_2796
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     MAV_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 GIDA NAD_binding_8 Pyr_redox_2 Thi4 FAD_binding_3 HEAT_2 HI0933_like 3HCDH_N Pyr_redox_3 NAD_Gly3P_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABK64600
UniProt: A0A0H2ZSI7
Position
2822398..2823363
Genome map
AA seq 321 aa AA seqDB search
MARNQQIVVIGAGVSGLTSAICLAEAGWPVRVWADTMPADTTSAVAGAVWAPPRPAERAA
ETLRWTEHSLRVFTELARDPDSGVQLAPALAVGELTASEAMSTAASLIPELRPADPADLP
PGYRTGFHATVPMIDMPHYLGYLTRRLTAAGGEIEEHRVGSLDEVADHADIVVNCAGLRA
GALTGDDTVRPLFGQHVVLTNPGVRQLFMELNDGPEWTCYFPHPQRVVCGGISIAGRWDT
TADPAVTERILQRCRRIEPRLGEAEVIEVITGLRPDRPSVRLQAEPLRRARCIHNYGHSS
NGVTLSWGCARDVLALVDDAR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaaccagcagatcgtcgtgatcggggccggcgtgagcggactgacgtcggcc
atctgtctggccgaggcgggatggccggtccgcgtgtgggcggacacgatgccggcggac
acgacctcggcggtggccggcgccgtctgggcaccgccgcggcccgccgaacgcgcggcc
gagacgctgcgctggaccgagcactcgttgcgggtgttcaccgaactcgcccgcgacccc
gattcgggtgtgcagctggcgccggcgctggctgtcggcgagctgaccgcctccgaggcg
atgtcgacggcggcctcgctgatccccgagctgcgcccggccgacccggccgacctcccg
cccggctatcgaaccggatttcacgccaccgtgccgatgatcgacatgccgcactatctc
ggctatctgacccggcggctgacggcggccggaggcgagatcgaggagcaccgggttggc
tcgctggacgaggtcgccgaccacgccgacatcgtcgtcaactgcgcgggcctgcgcgcg
ggcgcgctcaccggagacgacaccgtccggccgctgttcggtcagcacgtcgtgctcacc
aatcccggtgtgcgccaactgtttatggaactcaacgacggccccgagtggacctgctac
tttccgcacccgcagcgggtggtgtgcggcggcatcagcattgccggccgctgggacacc
accgcggaccccgccgtgaccgaacggattctgcagcgctgccgccgaatcgagccacga
ctgggcgaagccgaggtgatcgaggtgatcaccgggctgcggccggaccgtccgtcggtg
cgcctgcaggccgaaccgctccgacgggcacgctgcatccacaattacgggcacagcagc
aacggcgtcaccctgtcctggggttgcgcgcgtgacgtgctggccctggtggacgacgct
cgctga

DBGET integrated database retrieval system