KEGG   Mycobacterium avium 104: MAV_3340Help
Entry
MAV_3340          CDS       T00433                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
mav  Mycobacterium avium 104
Pathway
mav00010  Glycolysis / Gluconeogenesis
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
mav01230  Biosynthesis of amino acids
Module
mav_M00002  Glycolysis, core module involving three-carbon compounds
mav_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_3340 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mav04147]
    MAV_3340 (pgk)
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     MAV_3340 (pgk)
Exosome [BR:mav04147]
 Exosomal proteins
  Proteins found in most exosomes
   MAV_3340 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ABK68540
UniProt: A0QHY4
Position
complement(3483058..3484305)
Genome map
AA seq 415 aa AA seqDB search
MAVHNLKDLLAEGVSGRGVLVRSDLNVPLDSDGEQGRITDPGRITASVPTLSALVEAGAK
VVVAAHLGRPKNGPDPALSLAPVAAALGEQLGRHVQLASDVVGTDALARAEGLTDGDVLL
LENIRFDARETSKDDAERLALARQLAELVGPTGAFVSDGFGVVHRKQASVYDVATLLPHY
AGTLVAEEIAVLEQLTGSTKRPYAVVLGGSKVSDKLGVIESLATKADSIVIGGGMCFTFL
AAQGFSVGKSLLETEMVDTCRRLLDTYVDVLRLPVDIVAADRFAADAAPQTVPADAIPDD
LMGLDIGPGSVKRFTALLSNAETIFWNGPMGVFEFPAFAAGTKGLAEAIAAATGKGAFSV
VGGGDSAAAVRALGIPESGFSHISTGGGASLEYLEGKALPGIEVLGRPQPTGGAA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtccacaatctcaaagaccttctcgccgaaggtgtttccggacgcggtgtgctg
gtgcgttcggacctgaacgtgccgctggactccgatggtgagcaaggccggatcaccgac
cccggccggatcaccgcgtcggtgccgacgttgagcgcactggtcgaggcgggcgccaag
gtggtggtcgccgcgcacctcgggcgtcccaagaatgggccggacccggcgttgtcgctg
gccccggtggccgccgcgctcggcgagcagctgggccggcacgtgcagctggcctcggac
gtggtgggcaccgacgccctggcccgcgccgaggggttgaccgacggcgacgtcctgctg
ctggaaaacatccggttcgacgcccgcgaaacgtccaaggacgacgccgagcggctcgcg
ctggcccggcagctggccgaattggtcggtcccacaggcgctttcgtctccgacggtttc
ggcgtggtgcaccgcaagcaggcctcggtgtacgacgtcgccacgctgctgccgcactac
gccggcacgctggtggccgaggagatcgccgtgctggagcagctgaccggctcgaccaaa
cgcccctacgcggtggtgctcggcgggtccaaggtgtccgacaagctcggcgtcatcgag
tcgctggccaccaaggccgacagcatcgtcatcggcggcggcatgtgcttcacctttctt
gctgcgcaagggttttcggttggtaagtcgctgctagaaaccgagatggtggacacctgc
cgccggctgctggacacctacgtcgacgtgctgcggctgccggtggacatcgtggcggcc
gacaggttcgccgccgacgcggcgccgcagaccgtgccggccgacgccatccccgacgac
ctgatgggcctggacatcgggccgggatcggtcaagaggttcaccgcgctgctgtccaac
gccgagacgatcttctggaacggcccgatgggcgtgttcgagttcccggcgttcgccgcg
ggcaccaagggcctggccgaagcgatcgccgcggcgaccggcaagggcgccttctccgtg
gtcggcggcggcgactcggcggccgcggtgcgcgcgctgggcatcccggagagcggcttc
tcgcacatttccaccggcggcggggcgtcgctggaataccttgagggcaaggcacttccg
ggcatcgaggtgctgggacgtccgcaaccgacgggaggcgccgcgtga

DBGET integrated database retrieval system