KEGG   Mycobacterium avium 104: MAV_4239Help
Entry
MAV_4239          CDS       T00433                                 

Gene name
pstS
Definition
(GenBank) phosphate ABC transporter, phosphate-binding protein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
mav  Mycobacterium avium 104
Pathway
mav02010  ABC transporters
mav02020  Two-component system
mav05152  Tuberculosis
Module
mav_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:mav00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    MAV_4239 (pstS)
  Signal transduction
   02020 Two-component system
    MAV_4239 (pstS)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    MAV_4239 (pstS)
Transporters [BR:mav02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    MAV_4239 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 SBP_bac_1 PBP_like
Motif
Other DBs
NCBI-ProteinID: ABK65957
UniProt: A0A0H2ZUB9
Position
complement(4369494..4370594)
Genome map
AA seq 366 aa AA seqDB search
MSFARSGAVLSLLAAAALTLTGCGGDSKSSSGSGAHVDCGGKKVLKDSGSTAQQNAIEQF
VYAYVRACPGYTLDYNANGSGAGVTQFLNNQTDLAGSDIPLDPTTGQTDRAAARCNSPAW
DLPTVFGPIAVTYHLTGVSGLKLDGPTVAKIFNGAITKWDDPALKAVNPGLNLPSTPIAV
IFRSDKSGTTANFQKYLDGASNGAWGKGTSEMFTGGVGQGASGNNGTSALLQNTEGSITY
NEWSFAVGKQLSMASIITSAGPDAVPITKESVEKTIAGATFQGQGNDLVLDTSSFYRPTQ
QGAYPIVLATYEIVCSKYPDAATGSAVKAFMQAAIGPGQDGLDQYGSIPLPGSFTAKLSS
AVNAIS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgctcgatctggcgccgtactgagcctgctggccgccgccgcgttgacgctg
acggggtgcggcggcgactccaagtcgtcgtcggggtcgggcgcgcacgtggactgcggc
ggcaagaaggtgctcaaggacagcgggtccaccgcccagcagaacgcgatcgagcaattc
gtctacgcctacgtccgggcctgcccgggctacacgctggactacaacgcgaacggctcc
ggcgccggtgtcacgcagttcctcaacaatcagaccgacctcgcgggttcggatatcccg
ctggaccccaccaccggccagaccgaccgggcggcggcgcggtgcaattcgcccgcctgg
gacctgccgaccgtgttcgggccgatcgcggtgacctaccacctcaccggggtgagcggg
ctcaaactggacgggccgaccgtcgcgaagatcttcaacggcgccatcaccaagtgggac
gacccggcgctcaaggcggtcaatccgggcctcaacctgccgtcgacgcccatcgcggtg
atcttccgcagcgacaagtccggcaccaccgccaactttcagaagtacctggacggggcg
tccaacggcgcctggggcaagggcaccagcgagatgttcaccggcggcgtcgggcagggg
gccagcggcaacaacggcacctcggcgctgctgcagaacaccgaggggtcgatcacctac
aacgagtggtcgttcgcggtcggcaagcagctgagcatggcgtcgatcatcacctcggcg
gggccggacgcggtgcccatcaccaaggagtccgtcgagaagaccatcgccggggccacc
tttcaggggcagggcaacgacctggtgctggacacctcgtcgttctaccggcccacccag
cagggcgcctacccgatcgtgctggcgacctacgaaatcgtctgctcgaaatatccggac
gcggcgacggggtccgcggtgaaggcgttcatgcaggccgcgatcggtcccggccaggac
ggtctggaccagtacggttccatcccgctgccgggttcgttcacggcaaagctgtcgagc
gcggtcaatgcgatttcctga

DBGET integrated database retrieval system