KEGG   Mycobacterium avium 104: MAV_4243
Entry
MAV_4243          CDS       T00433                                 

Definition
(GenBank) acyl-CoA dehydrogenase
Organism
mav  Mycobacterium avium 104
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 PucR
Other DBs
NCBI-ProteinID: ABK64547
UniProt: A0A0H2ZSD9
Position
complement(4374170..4375339)
AA seq 389 aa
MAGWAGNPDFDLFQLPEEHQELRAAIRALAEKEIAPHAADVDENSRFPQEALEALNAAGF
NAVHVPEEYGGQGADSVAACIVIEEVARVDTSASLIPAVNKLGTMGLILRGSDELKKQVL
PSIADGSAMASYALSEREAGSDAASMRTRARADGDDWILNGAKCWITNGGKSSWYTVMAV
TDPDKGANGISSFMVHKDDEGFTVGPKEKKLGIKGSPTTELYFENCRIPGDRIIGEPGTG
FKTALATLDHTRPTIGAQAVGIAQGALDAAIAYTKERKQFGRPVSDNQGVQFMLADMAMK
VESARLMVYHAAARAERGESHLGFISAASKCLASDVAMEVTTDAVQLFGGYGYTQDFPVE
RMMRDAKITQIYEGTNQIQRVVMSRALLR
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggctggatgggccggaaaccccgacttcgatctgttccaactgcccgaggagcaccag
gagctgcgtgccgcgatccgggcgctggcggaaaaggagatcgctccgcacgccgccgac
gtggacgagaactcccggttcccgcaggaggcgctggaggcgttgaacgcggcggggttc
aacgccgtgcacgtgccggaggagtacggcgggcagggcgccgactcggtggcggcctgc
atcgtcatcgaggaggtcgcccgcgtcgacacctcggcgtcgctgatccccgcggtcaac
aagctgggcaccatggggctgatcctgcgcggctccgacgagctgaagaagcaggtgctg
ccgtcgatcgcggacggctcggcgatggcgtcctacgcgctctccgagcgcgaggccggc
agcgacgcggcgtcgatgcgcacccgggcccgcgccgacggggacgactggatcctcaac
ggcgccaagtgctggatcaccaacggcggcaagtcgagctggtacacggtgatggcggtg
accgatccggacaagggcgccaacggcatctcgtcgttcatggtgcacaaggacgacgag
ggcttcaccgtcgggcccaaggagaagaagctcggcatcaagggctcgccgaccaccgag
ctgtacttcgagaactgccgcatcccgggcgaccggatcatcggcgagccgggcacgggc
ttcaagaccgcgctggcgacgctggaccacacccggcccaccatcggcgcccaggccgtc
gggatcgcgcagggcgcgctggacgccgccatcgcatacaccaaggagcgcaagcagttc
ggccgaccggtcagcgacaaccagggtgtgcagttcatgctcgctgacatggcgatgaag
gtggagtcggcccggctgatggtgtaccacgccgccgcccgcgccgagcgcggcgaatcg
cacctggggttcatctccgcggcgtcgaagtgcctggcgtccgacgtcgcgatggaggtg
accacggacgcggtgcagctgttcggcggctacgggtacacgcaggacttcccggtcgag
cggatgatgcgcgacgccaagatcacccagatctacgagggcaccaatcagattcagcgg
gtggtgatgtcgcgggcgctgttgcgctga

DBGET integrated database retrieval system