KEGG   Mycobacterium avium 104: MAV_4295Help
Entry
MAV_4295          CDS       T00433                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mav  Mycobacterium avium 104
Pathway
mav00240  Pyrimidine metabolism
mav00983  Drug metabolism - other enzymes
mav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAV_4295
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    MAV_4295
Enzymes [BR:mav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MAV_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: ABK69394
UniProt: A0A0H3A3T6
Position
complement(4426313..4427596)
Genome map
AA seq 427 aa AA seqDB search
MRPGFDAPTVIRTKRDGGRLSDAAIDWVIDAYTRGLVAEEQMAALLMAILLRGMDGGETA
AWTSAMLASGDRLDFSDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLDAIAGFSAQLPSRRVREQLREVGAAIFAAGDLAPADAKLYALRDITATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGALVKTEEQCRDLAHTMVGLGAAHGVPTRALLT
DMNRPLGATVGNALEVAEALEVLAGGGPPDVVELTLRLAAEMLALAGVGDRDPADTLHDG
TAMDRFRRLVAAQGGDLSVPLPIGRHSETVTAPRGGTMGDIDAMAVGLAAWRLGAGRSRP
GERVQAGAGLRIHRRPGEPVAAGEPLFTLHTDTPERFGAALAELDGGWNVGDGAPAPRPL
IIDRIVT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgggttcgacgcgcccacggtgatcaggaccaagcgcgacggcggccggctg
tccgacgccgccatcgactgggtgatcgacgcctacacccgcggcctggtggccgaggag
cagatggcggccctgttgatggccatcctgctgcgcggcatggacggcggcgagaccgcc
gcctggacgtcggcgatgctggcctccggcgaccggctggacttctccgacctgggtgtg
ccgacggtggacaagcactccaccggcggggtgggcgacaagatcaccctgccgctggtg
ccggtcgtcgccgcctgcggggcggcggtgccgcaggcctcgggccgcgggctcggccac
accggcggcaccctggacaagctggacgcgatcgccgggttcagcgcgcagctgcccagc
cggcgggtgcgtgagcagctgcgcgaggtcggggcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacatcaccgccaccgtggaatcgctg
ccgctgatcgccagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggctcgggggcgttggtgaagaccgaggagcagtgccgcgacctg
gcgcacaccatggtcgggctgggcgccgcgcacggggtgcccacccgcgcgctgctcacc
gacatgaaccgcccgctgggcgcgaccgtcggcaacgcgttggaggtggccgaggcgctc
gaggtgctggccgggggcgggccgcccgatgtcgtcgagctgacgctgcggctggccgcc
gagatgctcgcgctggccggggtcggcgaccgggaccccgccgacaccctgcacgacggc
accgcgatggaccggttccgccgtctggtcgccgctcaagggggtgatttgtcggtaccg
ttgccgatcggtaggcactccgagaccgtgaccgctccccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggcgcgggaagatcccgtccg
ggcgaacgggtgcaagccggcgccggcctccggattcaccgccgccccggcgagccggtc
gccgccggcgagccgctgttcaccctccacaccgacaccccggaacgcttcggcgccgcg
ctggccgagctggacggcggctggaacgtcggcgacggcgcgccggcgccgcgaccgctg
atcatcgatcggatcgtcacatga

DBGET integrated database retrieval system