KEGG   Mycobacterium avium 104: MAV_4298Help
Entry
MAV_4298          CDS       T00433                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mav  Mycobacterium avium 104
Pathway
mav00020  Citrate cycle (TCA cycle)
mav00190  Oxidative phosphorylation
mav00650  Butanoate metabolism
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
Module
mav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAV_4298
   00650 Butanoate metabolism
    MAV_4298
  Energy metabolism
   00190 Oxidative phosphorylation
    MAV_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF5345 CybS
Motif
Other DBs
NCBI-ProteinID: ABK66227
UniProt: A0A0H2ZV33
Position
4428604..4429074
Genome map
AA seq 156 aa AA seqDB search
MSTPDLQLGPGQIAPVKQRFYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGVALFVL
AIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNISG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgacctgcagctcggcccgggccagatcgccccggtcaaacagcgcttc
tacgaccgcccggccagcctggacaatccccgctccccgcggcgccgcgccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctccggcgtcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacgacggcgtgtaccgcatcgacttc
aactacgtggcgcagcgctgggcgtcgccgttctggcagttctgggacctggcgctgctg
tggctggcccagctgcacggcggcaacgggctgcgcaccatcatcgacgactacagccgc
aaggacagcacccggttctggctgaacagcctgctgctgctgtcgatgggcttcaccctg
gtgctgggcacctacgtgctgctgaccttcgacccgaacatctcgggatag

DBGET integrated database retrieval system