KEGG   Mycobacterium avium 104: MAV_4384
Entry
MAV_4384          CDS       T00433                                 

Gene name
glmM
Definition
(GenBank) phosphoglucosamine mutase
  KO
K03431  phosphoglucosamine mutase [EC:5.4.2.10]
Organism
mav  Mycobacterium avium 104
Pathway
mav00520  Amino sugar and nucleotide sugar metabolism
mav01100  Metabolic pathways
Module
mav_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAV_4384 (glmM)
Enzymes [BR:mav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     MAV_4384 (glmM)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV AlaDh_PNT_N
Other DBs
NCBI-ProteinID: ABK65334
UniProt: A0QKT1
Position
complement(4521408..4522742)
AA seq 444 aa
MGRLFGTDGVRGVANRELTAELALALGAAAARQLASGSAPGRRVAVIGRDPRASGEMLEA
AVIAGLTSQGVDALRVGVLPTPAVAYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHK
LDDGTEDRIEALVGDAGPRPVGAGIGRVIDAEDAADRYLRHLSKASTLRLDGLTVVVDCA
HGAASSVAPRAYRAAGARVIAINADPNGLNINDNCGSTHLDSLRAAVVAHRADLGLAHDG
DADRCLAVDADGNLVDGDHIMVVLALAMREAGELASDTLVTTVMSNLGLHLAMRSAGITV
RTTGVGDRYVVEELRAGDYSLGGEQSGHIVMPALGSTGDGIVTGLRLMTRMAQTGSPLSD
LASAMQTLPQVLINVTVADKATAATAPSVQTAVGQAAAELGDTGRILLRPSGTEPMIRVM
VEAPEKDIAQRLATRVAEAVSAAR
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgggtcgactattcggcaccgacggcgtgcgcggggtcgccaatcgcgagttgaccgct
gagctggcgctggcgctgggcgccgcggcggcgcggcagctggccagcgggtccgcgccg
ggccggcgggtcgcggtgatcggccgcgatccacgcgccagcggcgagatgctggaggcc
gcggtgatcgccgggctgaccagtcaaggcgtcgacgcgctgcgggtgggggtgctgccc
acccccgcggtggcctacctgaccggcgcctacgacgccgacttcggggtgatgatctcg
gcgtcgcacaacccgatgcccgacaacggcatcaagatcttcggccccggcggccacaag
ctcgacgacggcaccgaggaccggatcgaagccctggtcggggacgccgggccgcggccg
gtcggcgcgggcatcggccgggtgatcgacgccgaggacgccgccgaccgctacctgcgc
cacctgagcaaggccagcacgctgcgcctggacgggctgaccgtggtggtcgactgcgcg
cacggcgcggcctcctccgtggccccgcgcgcctaccgcgcggccggcgcgcgggtgatc
gcgatcaacgccgaccccaacgggctcaacatcaacgacaactgcgggtcgacgcatctg
gattcgctgcgcgccgccgtcgtcgcccaccgcgctgacctgggcctggcgcacgacggg
gacgccgaccgctgcctggccgtcgacgccgacggcaacctggtcgacggcgaccacatc
atggtggtgctcgcgctggcgatgcgtgaggccggcgagctggcgtccgacacgttggtg
accaccgtgatgagcaacctgggactgcacctggcgatgcggtcggccggaatcacggtg
cgcaccaccggtgtcggcgaccgctacgtggtcgaggagctgcgcgccggtgactacagc
ctgggcggtgagcagtccgggcacatcgtgatgcccgcgctgggctcgaccggcgacggc
atcgtcaccgggctgcggttgatgacgcgcatggcgcagaccggctcgccgctgtccgat
ctggcgtcggcgatgcagacgctgccccaggtgctgatcaacgtgacggtcgccgacaag
gccaccgccgccaccgcaccgtcggtgcagaccgccgtcggccaggccgcggccgaactg
ggcgacaccggccgaatcctgttgcgcccgagcggaaccgagccgatgatccgcgtcatg
gtggaagcacccgagaaagacatcgcgcagcgactcgccacccgggtcgccgaggcggtc
agcgccgcgcgctga

DBGET integrated database retrieval system