KEGG   Mycobacterium avium 104: MAV_4492
Entry
MAV_4492          CDS       T00433                                 

Gene name
rpsL
Definition
(GenBank) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
mav  Mycobacterium avium 104
Pathway
mav03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mav00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MAV_4492 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mav03011]
    MAV_4492 (rpsL)
Ribosome [BR:mav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    MAV_4492 (rpsL)
  Bacteria
    MAV_4492 (rpsL)
  Archaea
    MAV_4492 (rpsL)
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-ProteinID: ABK68750
UniProt: A0QL38
Position
complement(4619878..4620252)
AA seq 124 aa
MPTIQQLVRKGRRDKIGKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ
VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK
KEKS
NT seq 375 nt   +upstreamnt  +downstreamnt
atgccaaccattcagcagctggtccgcaagggtcgtcgggacaagatcggcaaggtcaag
accgcggctctcaagggcagcccgcagcgccgtggcgtatgcacccgcgtgtacaccacc
accccgaagaagccgaactcggcgcttcggaaggtcgcccgcgtgaagctgacgagccag
gtcgaggtcaccgcctacatccccggcgagggccacaacctgcaggagcactccatggtg
ctggtgcgcggcggccgggtgaaggacctgcccggtgtgcggtacaagatcatccgcggc
tcgctggacacccagggtgtcaagaaccgcaagcaggctcgcagccgttacggcgccaag
aaggagaagagctga

DBGET integrated database retrieval system