KEGG   Mycobacterium avium subsp. avium 2285 (S): LA64_12860Help
Entry
LA64_12860        CDS       T03691                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mava  Mycobacterium avium subsp. avium 2285 (S)
Pathway
mava00640  Propanoate metabolism
mava00650  Butanoate metabolism
mava00900  Terpenoid backbone biosynthesis
mava01100  Metabolic pathways
mava01110  Biosynthesis of secondary metabolites
mava01120  Microbial metabolism in diverse environments
mava01130  Biosynthesis of antibiotics
mava01200  Carbon metabolism
mava01212  Fatty acid metabolism
mava02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA64_12860
   00630 Glyoxylate and dicarboxylate metabolism
    LA64_12860
   00640 Propanoate metabolism
    LA64_12860
   00650 Butanoate metabolism
    LA64_12860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA64_12860
   00072 Synthesis and degradation of ketone bodies
    LA64_12860
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA64_12860
   00310 Lysine degradation
    LA64_12860
   00380 Tryptophan metabolism
    LA64_12860
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA64_12860
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA64_12860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA64_12860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mava04147]
    LA64_12860
Enzymes [BR:mava01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA64_12860
Exosome [BR:mava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA64_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_aCoA_assoc
Motif
Other DBs
NCBI-ProteinID: AIR24038
Position
complement(2674115..2675599)
Genome map
AA seq 494 aa AA seqDB search
MTVDPRTPVLIGYGQVNHRDDIDPAVRSVEPVDLMAAAVERAADAAVIEAVDSIRVVNIL
SAQYRDPGLLLGQRIGARDFGTLYTPVGGNVPQSLVNQACLDIQRGRANVVLLAGAETWR
TRRGLRAKGGKLVWTEQDRSVPMAEVSGEDVAMAGEAEIRISLDRPAYVYPLFEQALRVS
TGESVEDHLTRIGRLWARFNAVAVDNPHAWIRTPHSADDICRAGPHNRMISWPYTKLMNS
NNMVDQGAALVLTSVEQARRLKVPPERWVYPLAGTDAHDTASIAERHELHRSAAIRIAGA
RALQLAGLGIDDVDHVDLYSCFPSAVQVAAAELGLGLDDPARPLTVTGGLTFAGGPWSNY
VMHSIATMAELLVANPGRRGLITANGGYLTKHSFGVYGTEPPAEFRWEDTQSAVDREPTT
DAAVEWEGVGTVEAWTTPHDREGEPEKAFLAVRTPDGSRALAVVTDRAAAQATVREDIGG
AKVAVAADGSAALQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgacccccgcaccccggtgctgatcggctacggccaggtcaaccaccgcgac
gacatcgacccggcggtccgctccgtcgagcccgtcgacctgatggccgccgccgtcgag
cgggccgccgacgccgcggtgatcgaggcggtggattccatccgggtggtcaacatcctc
tcggcgcagtatcgcgatcccgggctgctgctcggccagcgcatcggcgcccgcgacttc
ggcacgctgtacaccccggtcggcggcaacgtgccgcaatcgctggtcaaccaggcatgc
ctggatatccagcggggccgcgccaacgtggtgctgctggccggcgccgaaacctggcgc
acccgacggggattgcgggccaagggcggcaaactggtctggaccgagcaggaccgctcg
gtgccgatggccgaggtcagcggcgaagacgtggcgatggccggcgaggccgagatcagg
atctccctggaccggccggcctacgtctaccccctgttcgagcaggcgctgcgggtgtcc
accggcgagtcggtcgaggaccacctcacccgcatcgggcggctgtgggcgcggttcaac
gcggtggcggtggacaacccgcacgcctggatccgcaccccgcacagcgccgacgacatc
tgccgggcggggccgcacaaccggatgatcagctggccgtataccaagttgatgaactcc
aacaacatggtcgaccagggtgcggcgctcgtactgacctcggtggagcaggcgcgacgg
ctgaaggtcccgcccgagcggtgggtctacccgctggcgggcacggatgcgcatgacacc
gcgtccatcgccgaacgccacgagctgcaccgctcggcggccatccggatcgccggcgcc
cgggcgctgcaactggccgggctgggcatcgacgacgtcgaccacgtggacctgtactcg
tgctttccctccgcggtacaggtggcggcggccgaactcgggctgggcctcgacgacccc
gcccgaccgctcacggtgaccggcgggctgacgtttgcgggcgggccgtggagcaactac
gtcatgcactccatcgccaccatggccgagttgctggtggccaatcccgggcggcgtggt
ttgatcaccgccaacggcggctacctgaccaagcacagcttcggcgtctacggcaccgaa
ccgccggccgaattccgttgggaggacacccaatcggccgtcgaccgggagccgacgacc
gatgcggcggtcgagtgggagggcgtcggcaccgttgaggcctggacgacgccccacgac
cgcgagggtgagccggagaaggcgttcctggcggtgcgcaccccggacgggtcgcgcgcc
ctggccgtcgtcaccgatcgcgccgccgcgcaggcaaccgtgcgcgaggacatcggtggc
gccaaggtcgccgtcgccgccgacggcagcgcggcgctgcagtag

DBGET integrated database retrieval system