KEGG   Mycobacterium avium subsp. avium DJO-44271: NF84_02880Help
Entry
NF84_02880        CDS       T03430                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mavd  Mycobacterium avium subsp. avium DJO-44271
Pathway
mavd00071  Fatty acid degradation
mavd00072  Synthesis and degradation of ketone bodies
mavd00280  Valine, leucine and isoleucine degradation
mavd00310  Lysine degradation
mavd00362  Benzoate degradation
mavd00380  Tryptophan metabolism
mavd00620  Pyruvate metabolism
mavd00630  Glyoxylate and dicarboxylate metabolism
mavd00640  Propanoate metabolism
mavd00650  Butanoate metabolism
mavd00900  Terpenoid backbone biosynthesis
mavd01100  Metabolic pathways
mavd01110  Biosynthesis of secondary metabolites
mavd01120  Microbial metabolism in diverse environments
mavd01130  Biosynthesis of antibiotics
mavd01200  Carbon metabolism
mavd01212  Fatty acid metabolism
mavd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mavd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NF84_02880
   00630 Glyoxylate and dicarboxylate metabolism
    NF84_02880
   00640 Propanoate metabolism
    NF84_02880
   00650 Butanoate metabolism
    NF84_02880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NF84_02880
   00072 Synthesis and degradation of ketone bodies
    NF84_02880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NF84_02880
   00310 Lysine degradation
    NF84_02880
   00380 Tryptophan metabolism
    NF84_02880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NF84_02880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NF84_02880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NF84_02880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mavd04147]
    NF84_02880
Enzymes [BR:mavd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NF84_02880
Exosome [BR:mavd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NF84_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIV23711
Position
complement(579611..580804)
Genome map
AA seq 397 aa AA seqDB search
MAGAGPNIAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGCTFDDIDAVVVGKAPD
FFEGVMMPELFMADAVGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLAMAWEKQ
SESNAMWALSIPVPFIKPVGAGAGGYFAPHVRAYIRRSGAPTHIGAMVAVKDRLNGCRNP
LAHLHQPDITLEKVMESPMLWDPIRYDETCPSSDGACAVVIGNEEAAEARLAQGNPVAWI
HATALRTEPLAYAGRDQVSPQAGRDAAAALWKAAGIKSPIDEIDAAEIYVPFSWFEPMWL
ENLGFAPEGEGWKLTEAGETKIGGRLPVNPSGGVLSSNPIGASGLIRFAEAAIQVMGKGG
DHQVPGARKALGHAYGGGSQYYSMWVVGADKPAAEKV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgcagggccgaacatcgccgcggtactgggtaccggacaaacgaagtatgtg
gccaagcgccaagacgtttcgatgaacggcctggtgcgcgaggctatcgaccgcgcactg
gccgactcgggttgcaccttcgacgacatcgacgccgtggtggtcggcaaggcacccgac
ttcttcgagggcgtcatgatgcccgagctgttcatggccgacgccgtgggcgccaccggc
aagccgctgatccgggtgcacaccgccgggtcggtcggcggctccaccggggtggtggcc
gccagcctggtgcagtcgggcaagtaccggcgcgtgctggcgatggcctgggagaagcag
tcggagtcgaatgccatgtgggcgttgtcgattccggttccgttcatcaagccggtgggc
gcgggcgccggtggctatttcgccccgcacgtgcgggcctacattcgccgttccggagcg
ccgacgcacatcggcgccatggtcgccgtcaaggaccggctcaacggatgccgcaacccg
ttggcgcacctgcatcagcccgacatcaccctggagaaggtgatggagtcgccgatgctg
tgggacccgatccgctacgacgagacctgcccgtcgtcggacggtgcctgcgcggtggtg
atcggtaacgaggaggccgccgaagcccgtctggcgcaaggcaatccggtggcgtggatc
catgccacggcgttgcgcaccgagccgctggcctacgccgggcgcgaccaggtcagcccg
caggccgggcgtgacgcggccgccgcgctgtggaaggccgccggcatcaagagccccatc
gacgagatcgatgccgcggagatctacgtgccgttctcctggttcgagccgatgtggttg
gaaaacctcggctttgctcccgagggcgagggctggaagctcaccgaggcgggcgagacc
aagatcggcggccggctgccggtcaacccgtccggtggtgtgctgtcgtcgaacccgatc
ggcgcctcggggctgatccgcttcgccgaagcggccatccaggtgatgggcaagggcggc
gatcaccaggtgcccggcgcccggaaggcgttgggacacgcctacggtggcggctcgcag
tactactcgatgtgggtggtcggcgccgacaagcccgccgccgagaaggtctga

DBGET integrated database retrieval system