KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_15220Help
Entry
RC58_15220        CDS       T03787                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
Pathway
mavi00071  Fatty acid degradation
mavi00072  Synthesis and degradation of ketone bodies
mavi00280  Valine, leucine and isoleucine degradation
mavi00310  Lysine degradation
mavi00362  Benzoate degradation
mavi00380  Tryptophan metabolism
mavi00620  Pyruvate metabolism
mavi00640  Propanoate metabolism
mavi00650  Butanoate metabolism
mavi00900  Terpenoid backbone biosynthesis
mavi01100  Metabolic pathways
mavi01110  Biosynthesis of secondary metabolites
mavi01120  Microbial metabolism in diverse environments
mavi01130  Biosynthesis of antibiotics
mavi01200  Carbon metabolism
mavi01212  Fatty acid metabolism
mavi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC58_15220
   00630 Glyoxylate and dicarboxylate metabolism
    RC58_15220
   00640 Propanoate metabolism
    RC58_15220
   00650 Butanoate metabolism
    RC58_15220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RC58_15220
   00072 Synthesis and degradation of ketone bodies
    RC58_15220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC58_15220
   00310 Lysine degradation
    RC58_15220
   00380 Tryptophan metabolism
    RC58_15220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RC58_15220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC58_15220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RC58_15220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mavi04147]
    RC58_15220
Enzymes [BR:mavi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RC58_15220
Exosome [BR:mavi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC58_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJK76204
UniProt: A0A202FT18
Structure
PDB: 

Position
complement(3362014..3363225)
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLTEVKPLNLVVGLVDELRRRYPDLDESLISDMILGVVS
PVGDQGGDIARTAVLAAGLPETTGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAWATDPETNYRIGFVPQGIGADLIATLEGFSREDVDAYALRSQQKAAA
AWSGGYFAKSVVPVRDQNGLVILDHDEHMRPDTTMEGLAKLKTAFDGVGEMGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVLVGSEKAGKSQGLTPRARIVATATSGSDPVIML
TGPTPATRKVLDRAGLTIDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMITGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagcttttatctacgaagccatccgcacaccgcggggcaagcagaagaac
ggctcgctgaccgaggtgaagccgctcaacctggtggtaggcctggtcgacgagctgcgc
cggcgctaccccgacctggacgagagcctgatcagcgacatgatcctgggtgtcgtgtcc
ccggtcggcgaccagggtggcgacatcgcccgcaccgcggtgctggccgccggcctgccc
gagaccaccggcggcgtgcagctcaaccggttctgcgcctcgggcctcgaggccgtcaac
accgccgcccagaaggtgcgctccggctgggacgacctggtgctggccggcggtgtggag
tcgatgagccgggtcccgatgggctccgacggcggcgcctgggccaccgacccggagacc
aactaccggatcggcttcgtgccgcagggcatcggcgccgatttgatcgccaccctcgag
ggcttctcccgcgaggacgtcgacgcctacgcgctgcgcagccagcagaaggccgccgcg
gcctggtcgggcggctacttcgccaagtcggtggtgccggtgcgtgaccagaacggtctg
gtcatcctcgaccacgacgagcacatgcggcccgacaccacgatggagggcctggccaag
ctgaagaccgcgttcgacggtgtcggcgagatgggcggcttcgacgacgtggcgctgcag
aagtaccactgggtcgagaagatcaaccacgtccacaccggcggcaacagctcgggcatc
gtcgacggcgccgcgctggtgctggtcggcagcgaaaaggccggcaagtcgcaggggttg
accccgcgggcccgcatcgtggccaccgcgaccagcggctcggacccggtcatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgggccggcctgacgatcgacgac
atcgatctgttcgaactgaacgaggcgttcgcgtcggtggtgctgaagttccagaaagac
ctcaacattcccgacgagaagctcaacgtcaacggcggcgccatcgcgatgggccacccg
ctgggcgccaccggcgccatgatcaccggcaccatggtcgacgagctcgagcgccgcaac
gcgcgtcgcgccctgatcacgctgtgcatcggcggcggcatgggtgtcgccaccatcatc
gagagggtttaa

DBGET integrated database retrieval system