KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_16535Help
Entry
RC58_16535        CDS       T03787                                 

Definition
(GenBank) 4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
Pathway
mavi00360  Phenylalanine metabolism
mavi00362  Benzoate degradation
mavi00621  Dioxin degradation
mavi00622  Xylene degradation
mavi01100  Metabolic pathways
mavi01120  Microbial metabolism in diverse environments
mavi01220  Degradation of aromatic compounds
Module
mavi_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mavi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    RC58_16535
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC58_16535
   00622 Xylene degradation
    RC58_16535
   00621 Dioxin degradation
    RC58_16535
Enzymes [BR:mavi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     RC58_16535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AJK76434
Position
complement(3610141..3611199)
Genome map
AA seq 352 aa AA seqDB search
MTTDIFFNPIWDVRLTDTSLRDGSHHKRHQFTKDEVQAIVAALDAAGVPVIEVTHGDGLG
GSSFNYGFSKTPEQELIKLAAETAKDAKIAFLMLPGVGTKEDIKEAQNNGGSICRIATHC
TEADVSIQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALV
LEGVRDRVAALVAELGDDAQVGFHGHENLGLGVANSVEAVRAGAKQIDGSCRRFGAGAGN
APVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFLK
HAIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQESGAAAAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgatatcttcttcaacccgatttgggacgtccggctgaccgacacgtcgctg
cgcgacggcagccaccacaagcgccaccagttcaccaaggacgaggtgcaagccatcgtc
gcggccctggacgccgcgggggtgccggtcatcgaggtcacccacggcgacgggctgggc
ggctcgagcttcaactacgggttctccaagacccccgagcaggagctgatcaagctggcc
gccgagaccgccaaggacgccaagatcgccttcctgatgctgcccggggtgggcaccaag
gaggacatcaaggaggcccagaacaacggcggctcgatctgccggatcgccacgcactgc
accgaggccgacgtgtccatccagcacttcggcctggcccgcgaactcgggctggagacc
gtcggcttcctgatgatgagccacaccatcccgccggaaaagctcgcccagcaggcccgc
atcatggccgacgccggctgccagtgcgtctacgtggtcgactcggccggcgcgctggtg
ctcgagggcgtgcgcgaccgggtggccgcgctggtcgccgagctgggcgacgacgcccag
gtcggtttccacgggcacgagaacctcgggctcggggtggccaacagcgtcgaggccgtc
cgggccggcgccaagcagatcgacggctcgtgccgccggttcggggccggggcgggcaac
gcgcccgtcgaggcgctgatcggcgtgttcgacaagatcggcgtcaagaccggcatcgac
ttcttcgacatcgccgacgccgccgaggaggtggtcgcgccggccatgcccgccgagtgc
ctgctcgaccgcaacgccctgatcatgggctattccggggtgtactcgagcttcctcaag
cacgccatccgccagtccgagcgctacggggtgcccgcacaccagctgctgcaccgggcc
ggtcagcgcaaactcatcggcggtcaggaagaccagctgatcgacatcgcgctggagatc
aagcgcgagcaggaaagcggtgccgcggcggcgcgctga

DBGET integrated database retrieval system