KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_03795Help
Entry
LA63_03795        CDS       T03342                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
Pathway
mavr00071  Fatty acid degradation
mavr00072  Synthesis and degradation of ketone bodies
mavr00280  Valine, leucine and isoleucine degradation
mavr00310  Lysine degradation
mavr00362  Benzoate degradation
mavr00380  Tryptophan metabolism
mavr00620  Pyruvate metabolism
mavr00630  Glyoxylate and dicarboxylate metabolism
mavr00640  Propanoate metabolism
mavr00650  Butanoate metabolism
mavr00900  Terpenoid backbone biosynthesis
mavr01100  Metabolic pathways
mavr01110  Biosynthesis of secondary metabolites
mavr01120  Microbial metabolism in diverse environments
mavr01130  Biosynthesis of antibiotics
mavr01200  Carbon metabolism
mavr01212  Fatty acid metabolism
mavr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mavr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA63_03795
   00630 Glyoxylate and dicarboxylate metabolism
    LA63_03795
   00640 Propanoate metabolism
    LA63_03795
   00650 Butanoate metabolism
    LA63_03795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA63_03795
   00072 Synthesis and degradation of ketone bodies
    LA63_03795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA63_03795
   00310 Lysine degradation
    LA63_03795
   00380 Tryptophan metabolism
    LA63_03795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA63_03795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA63_03795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA63_03795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mavr04147]
    LA63_03795
Enzymes [BR:mavr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA63_03795
Exosome [BR:mavr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA63_03795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Gemin7
Motif
Other DBs
NCBI-ProteinID: AIR55177
UniProt: X8B5F4
Position
727296..728435
Genome map
AA seq 379 aa AA seqDB search
MAEAVIVSALRTPIGTARKGTLRDTSAFDLAHHVVSEAVKDIDPTQVDDVILGEGLYGGG
VLARHAAITAGLTQVPGLANNRHCAAGQAAVQSAAASVRAGMDQLVIAGGVNSASTSPRS
RMQVDGEWVDWFPPTHPDRPDAPNMDMSITVGWNAAVKAGVSREEMDAWALRSHRNAIAA
IDEGRFKEEIVPIDTPHGLFSIDEHPRRDTSMEKLAALKPLHPEIEGFSITAGNACGAND
GAAVLTIASDRLGLRPLATIRSWASVGVDPAITGLAPVEAIPKALGRAGLSISDVDLFEI
NEAFAAMCVATVKLLELDPDKVNVSGSGCSLGHPVAATGARMLVTLVHELRRRGGGIGVA
AMCAGGGMGSATVIEVAGE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagccgtcatcgtgtccgcgctgcgcacacccatcggaactgcccgcaagggc
accctgcgcgacaccagcgcattcgacctggcgcaccacgtcgtcagcgaagcggtgaag
gatatcgacccgacccaggtcgacgacgtgatcctgggcgagggcctctacggcggcggc
gtgctggcccggcacgcggccatcacggcggggctgacccaggtgcccggcctggccaac
aaccggcactgcgcggcgggtcaggcggccgtacagagcgccgcggccagcgtgcgcgcc
ggaatggaccaactggtcatcgccggcggcgtcaactcggcttccacgtcgccgcgatcg
cggatgcaggtcgacggcgagtgggtcgactggttcccgccgacccacccggaccggccc
gacgccccgaacatggacatgtcgatcaccgtcggctggaacgctgccgtcaaagccggg
gtgagccgcgaggagatggacgcctgggcgctgcggtcgcaccgcaacgccatcgccgcc
atcgacgagggccgcttcaaagaggagatcgtgcccatcgacaccccgcacgggctgttc
tcgatcgacgaacacccgcgccgcgacaccagcatggagaagttggccgcgctcaagccg
ttacatccggaaatcgagggcttctccatcaccgccggcaacgcctgcggcgccaacgac
ggtgccgcggtgctgacgatcgccagcgaccggctcgggctgcggccgttggccaccatc
cggtcctgggcgtcggtcggggtcgacccggcgatcaccggcctggcgccggtggaggcg
ataccgaaagcccttgggcgcgccgggctttcgatctccgatgtggacctcttcgagatc
aacgaggccttcgcggcgatgtgtgtggccacggtcaagctgcttgaactcgaccccgac
aaggtcaacgtcagcggcagcggctgctcgctggggcatcccgtggcggcgaccggggca
cggatgctggtcaccctggtgcacgaattgcgccgccgcggaggcggtatcggcgtcgcg
gcgatgtgcgcgggcgggggcatgggttcggcgacggtgatcgaggtcgcgggcgaataa

DBGET integrated database retrieval system