KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_09230Help
Entry
RE97_09230        CDS       T03847                                 

Definition
(GenBank) acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00860  Porphyrin and chlorophyll metabolism
mavu01100  Metabolic pathways
mavu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RE97_09230
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RE97_09230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mavu03032]
    RE97_09230
Enzymes [BR:mavu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     RE97_09230
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     RE97_09230
DNA replication proteins [BR:mavu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     RE97_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AJK79342
Position
2002582..2003715
Genome map
AA seq 377 aa AA seqDB search
MKVVIEADGGSRGNPGPAGYGAVVWTPDRGTVLAENKQAIGRATNNVAEYRGLLAGLGDA
LKLGATEAEVYLDSKLLVEQMSGRWKVKHPDLIELHAQARSLAARFDRISYTWIPRERNS
HADRLANEAMDAAAAATGTAEKPGPAEQSDPTAADAGKTAAAPSPAAPGWTGARGTPTRL
LLLRHGQTELSVQRRYSGRGNPALTETGRRQADAAARYLAARGGISAVFASPLQRAYDTA
AVVAKALGLDVTVDDDLIETDFGAWEGLTFGEAAERDPGLHRRWLRDTSTAPPGGESFDS
AAERVSRVRQKIIAAQQGSTVLVVSHVTPIKMLLREALDAGPGILYRLHLDLASLSIAEF
YSDGAASVRLVNQTGYL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgtcatcgaagccgacgggggatcgcgcggcaaccccggcccggccgggtac
ggcgccgtggtgtggacaccggaccgcggcaccgtgctggccgagaacaagcaggccatc
gggcgggccaccaacaacgtcgccgaatatcgcggcctgctagccggtttgggcgacgcg
ctgaagctgggcgccaccgaggccgaggtctacctggattccaaactgttggtggagcag
atgtcggggcggtggaaggtcaaacaccccgacctgatcgagctgcacgcccaggcccga
agcctggccgcgcgattcgacaggatcagctacacgtggatcccccgcgagcgcaactcg
cacgccgaccggctggccaacgaggcgatggacgcggccgccgcggccaccggcacggcg
gaaaagcccgggccggccgaacaatccgatccgaccgccgccgacgccgggaaaaccgcc
gcggcgccgtcacccgcggcgcccgggtggaccggcgcgcgcggcaccccgacccggctg
ctgttgctgcgacacgggcagaccgaattgtcggtgcagcggcgctattccgggcgcggc
aaccccgcactcaccgagacgggacggcggcaggccgacgcggcggcacgctatctggcc
gcgcgcggcgggatttcggcggtgttcgcctccccgctgcaacgggcctacgacaccgcg
gcggtcgtcgccaaggcgctgggcctggacgtgaccgtcgacgacgacctgatcgaaacc
gatttcggggcctgggaggggttgacgttcggcgaggccgccgagcgcgaccccggactg
caccggcgctggctgcgtgacaccagcaccgccccgcccggcggggagagcttcgactcg
gcggccgagcgggtgtcgcgggttcgccagaagatcatcgccgcacagcagggcagcacc
gtgctggtggtgtcgcacgtgacgccgatcaagatgctgctgcgggaggcgctggacgcc
gggccgggcatcctgtaccggttgcatctcgacctcgcctcgctgagcatcgccgagttc
tattccgacggagccgcttcggtgcggctggtcaaccagaccggatacctgtag

DBGET integrated database retrieval system