KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_14355Help
Entry
RE97_14355        CDS       T03847                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00450  Selenocompound metabolism
mavu00970  Aminoacyl-tRNA biosynthesis
mavu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RE97_14355
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RE97_14355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mavu01007]
    RE97_14355
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mavu03016]
    RE97_14355
Enzymes [BR:mavu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RE97_14355
Amino acid related enzymes [BR:mavu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RE97_14355
Transfer RNA biogenesis [BR:mavu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RE97_14355
 Prokaryotic type
   Other AARSs
    RE97_14355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Pellino
Motif
Other DBs
NCBI-ProteinID: AJK80242
Position
3168820..3170379
Genome map
AA seq 519 aa AA seqDB search
MRPFYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAA
AEGIGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDS
YSGWYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEA
NPDFIAPEVRRNEVVSFVSGGLRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGV
GYPDTESEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEK
MSKSVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTEDAIITRINTDLANELGNLA
QRSLSMIAKNLHSVVPEPGDFTGDDRELLQTADGLLPRVRASFDSQAMHLGLEAIWLMLG
EANKYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPESAGKLLDLLG
QGQDRRAFDALGARLAPGTVLPPPTGVFPRYQAESEKVD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccttctacgtcaccaccgcgatcacgtaccccaacggcgacccgcacgtcggg
catgcctacgagtacatcgccaccgatgccatcgcccggttcaagcggctcgacggcttc
gacgtgcgattcctgaccggcaccgacgagcacggcctcaagatggtcgagaccgcggcg
gccgagggcatcggcacggccgagctggcccggcgcaattccgatgtgttccagcggctg
caggagcggttgaacatctccttcgaccgcttcatccgcaccaccgaccccgatcatcac
gaagcgtccaaggcgatctggcggcggatgcaggcggccggcgacatctacctggacagc
tattccggttggtattcggtgcgcgacgagcggttcttcgtcgaatcggagaccaaggtg
ctcgacgacgggacgcgggtggccgccgaaaccggcgccccgctgacctggaccgaggag
caaacgtatttcttccggctgtcggcctacaccgacaagctgctggcccactacgaggcg
aacccggatttcatcgcccccgaggtgcggcgcaacgaggtggtcagcttcgtctccggc
ggcctgcgcgacctgtccatctcgcgcacctcgttcgactggggcgtcaaggtgcccgat
catcccgatcacgtcatgtacgtctgggtcgacgcgctcaccaactacctgaccggggtg
ggatacccggacaccgaatcggagatgttccgccgctactggccggccgatttgcacatg
atcggcaaggacatcatccggttccacaccgtgtactggccggcgtttctcatgtcggcc
ggaatcgagctgccccgaagggttttcgcgcacgggtttctgctcaaccgcggcgagaag
atgagcaagtcggtgggcaacatcgtcgacccgatcacgctggtggacaccttcggcgtc
gaccaactgcgctacttcctgctgcgcgaggtgccgttcggccaggacggcagctacacc
gaggacgcgatcatcacccggatcaacaccgatctggccaacgagctgggcaacctggcg
caacgctcgttgtcgatgatcgccaagaacctgcactcggtggtgcccgaacccggtgac
ttcaccggcgacgaccgtgaactgctgcagacggccgacggtttgttgccgcgggtgcgc
gccagtttcgactcgcaggcgatgcacctgggcctggaagcgatctggctgatgctcggt
gaggccaacaagtacttctcggcgcaacagccgtgggtgttgcgcaagagcgagtccgag
gcggatcagacgcgattccgcaccgtcttgtacgtcacctgcgaggtggtccgcatcgcc
gcgctgctggtgcagcccgtcatgcccgaatcggccggcaagctgctggatctgctgggg
cagggccaagatcggcgggcgttcgacgcgctgggcgcgcggctggctccgggtacggtg
ctgccgcctccgaccggtgtgtttccccgctaccaggcggagtcggagaaagtcgattga

DBGET integrated database retrieval system