KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_14730Help
Entry
RE97_14730        CDS       T03847                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00071  Fatty acid degradation
mavu00072  Synthesis and degradation of ketone bodies
mavu00280  Valine, leucine and isoleucine degradation
mavu00310  Lysine degradation
mavu00362  Benzoate degradation
mavu00380  Tryptophan metabolism
mavu00620  Pyruvate metabolism
mavu00630  Glyoxylate and dicarboxylate metabolism
mavu00640  Propanoate metabolism
mavu00650  Butanoate metabolism
mavu00900  Terpenoid backbone biosynthesis
mavu01100  Metabolic pathways
mavu01110  Biosynthesis of secondary metabolites
mavu01120  Microbial metabolism in diverse environments
mavu01130  Biosynthesis of antibiotics
mavu01200  Carbon metabolism
mavu01212  Fatty acid metabolism
mavu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RE97_14730
   00630 Glyoxylate and dicarboxylate metabolism
    RE97_14730
   00640 Propanoate metabolism
    RE97_14730
   00650 Butanoate metabolism
    RE97_14730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RE97_14730
   00072 Synthesis and degradation of ketone bodies
    RE97_14730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RE97_14730
   00310 Lysine degradation
    RE97_14730
   00380 Tryptophan metabolism
    RE97_14730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RE97_14730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RE97_14730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RE97_14730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mavu04147]
    RE97_14730
Enzymes [BR:mavu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RE97_14730
Exosome [BR:mavu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RE97_14730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NPCBM_assoc Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AJK80310
UniProt: A0A202FV35
Position
complement(3251160..3252683)
Genome map
AA seq 507 aa AA seqDB search
MNLDPNTPVIVGVGQFTERIEDSGYRGMSSVELATEAARAALHDCGADATALAAAVDTVA
AIRQFELSGRTPAPMGKSNNYPRSVARRIGAAPARAVLEPIGGQGPQHLVTEFAGIIAAG
DAEVVMIFGSENTSSIRYFADREKPDHSETVEGSLEDRGFGYEGLFDDYTVAHGLIGAPA
QYGLLENARRARLGLSVADYRRRMGELFAPFTKVAAKNPSASAPVERSVDELITVTPSNR
MICDPYPRLLVARDQVNQGAAALLMSVAAARRLRVPEERWVFLHGHADMVDQPLLDRLDL
TYNSASVLAVQEALAGAGIGIDDVSTFDLYSCFPVPVFNFCDGTGLATDDPRGLTLTGGL
PYFGGPGNNYSLHGIAETVSEMRDRPGQFGLVAANGGIMSKYSVGVYSTTPVNWKPDNSA
ALRAEVAARPTVPVTVRADGRATIETYTVRYDWPVRTGIIIGRLDDGSRFLALTEDPELV
GLLSDGEPLGTSIVVTATEKDNRATLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgaccccaacacccccgtcatcgtcggggtggggcagttcaccgagcgcatc
gaggactccgggtaccgcggcatgtcgtcggtggagctggcgacggaagcggcgcgggcc
gcgctgcacgactgcggggccgacgccaccgccctcgccgcggccgtcgacaccgtcgcc
gcgatccggcaattcgagctgtccgggcgcacgcctgcacccatgggtaagtccaacaac
tacccgcggtcggtcgcgcggcggatcggcgccgccccggcccgcgccgtcctcgaaccc
atcggcggccagggcccccagcatctggtcaccgagttcgccggcatcatcgccgcgggg
gacgccgaggtcgtgatgatcttcggctccgaaaacacttccagcatccggtatttcgcc
gaccgggagaagccggaccactccgagacggtcgagggttccctcgaggaccggggtttc
ggctacgaaggcctgttcgacgactacaccgtcgcccacggcctgatcggcgcgccggcc
cagtacgggctgctggagaacgcgcgccgcgcccggctgggcttgagcgtggccgactac
cggcgccggatgggcgagctgttcgccccgttcaccaaggtggcggccaagaacccgtcc
gcgtccgccccggtggaacgcagcgtcgacgagctcatcacggtgaccccgtccaaccgg
atgatctgcgatccctacccccggctgctggtggcccgcgaccaggtcaaccagggcgcg
gcggcgctgttgatgtcggtggccgccgcgcggcggctccgcgtgcccgaggagcgctgg
gtgttcctgcacggacacgcggacatggtggaccagccgctgctggaccgcctcgacctg
acctacaactcggcgtcggtgctggcggtccaggaggcgctggccggggcgggcatcggc
atcgacgacgtctcgacgttcgatctgtacagctgcttcccggtgccggtgttcaacttc
tgcgacggcacgggcctggccaccgacgatccgcgcggcctgacgctcaccggcggcctg
ccgtacttcggcggaccgggcaacaactactcgctgcacggcatcgccgagacggtcagc
gaaatgcgggaccggccaggccaattcggcttggtcgccgccaacggcgggatcatgagc
aagtactccgtcggggtgtactcgaccacgccggtgaactggaaacccgacaacagcgcc
gcgctgcgcgccgaggtcgccgcccgtcccacggttccggtgaccgtcagggcggacggt
cgcgcgaccatcgagacctacaccgtgcgctacgactggccggtgcgcaccggcatcatc
atcggccgcctcgacgacggcagccgctttttggccttgaccgaggatcccgagctggtc
ggcctgctcagcgacggcgagccgctcgggacgtcgatcgtggtcacggcgaccgagaag
gacaaccgggccacgctggcctga

DBGET integrated database retrieval system