KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_15650
Entry
RE97_15650        CDS       T03847                                 

Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00903  Limonene and pinene degradation
mavu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RE97_15650
Enzymes [BR:mavu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     RE97_15650
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: AJK80480
Structure
PDB: 
3UVE

Position
3439575..3440423
AA seq 282 aa
MTGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDL
AETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKT
SEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHG
VVGLMRAFGVELGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMF
HTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaccggacgtgttgagggcaaagtcgctttcgtcaccggggcggcacgcggtcagggc
cgcagccacgcggtgcggttggcccaggagggcgccgacatcatcgccgtcgacatctgc
aagcccatccgggcgggcgtggtggacaccgccatcccggcctccacgcccgaggacctg
gccgagaccgccgatctggtcaaggggcacaaccgcagaatcgtcaccgccgaggtcgac
gtgcgcgactacgacgcgctcaaagccgcggtcgacagcggcgtcgagcagctgggccgg
ctggacatcatcgtggccaacgccggaatcggcaacggcggcgacactttggacaagacc
agcgaagaagactggaccgagatgatcgacatcaacctggccggggtgtggaaaaccgtg
aaagccggtgtgccgcatatgatcgccggcggccgcggcggatccatcatcctgaccagc
tcggtcggcgggctcaaggcctacccgcacaccggccactacgtcgcggccaagcacggc
gtggtcgggctgatgcgcgccttcggagtcgagttgggacagcacatgattcgcgtcaat
tcggtacacccgacgcacgtcaagaccccgatgctgcacaacgagggcaccttcaagatg
ttccgtccggatctggagaacccgggtcccgacgacatggcgccgatctgccagatgttc
cacacgctgcccatcccgtgggtcgagccgatcgacatcagcaacgcggtgctgttcttc
gcctcggacgaagcccgctacatcaccggtgtgaccctgcccatcgatgcgggtagctgc
ctgaaatag

DBGET integrated database retrieval system