KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_16730Help
Entry
RE97_16730        CDS       T03847                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00983  Drug metabolism - other enzymes
mavu01100  Metabolic pathways
mavu01110  Biosynthesis of secondary metabolites
mavu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    RE97_16730
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RE97_16730
   00983 Drug metabolism - other enzymes
    RE97_16730
Enzymes [BR:mavu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     RE97_16730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AJK80670
Position
complement(3645496..3646326)
Genome map
AA seq 276 aa AA seqDB search
MTLDLGAYFDRIGYGGKAAPNLEVLRALMAAHTGSIPFENLDPLMGVPVDDLSPAALTDK
LVHRRRGGYCYEQNGLLGYALAEIGFRVRRLAGRVVWMQPPDTPPRAQTHTVLAVTFPGS
QGAYLVDVGFGGQTLPSPIRFETGNAQQTTHEPYRLDDRGEGLVLQALVRDEWPPLYVFG
TRTVPQIDLLVGSWYVSTHPSSMFVTGLMVARTTADARWNLAGRELTVHRAQSSEKIRLD
DADAVLDVLGERFGIDVAGIGQRGALLARIEQVLDA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggatctgggcgcgtatttcgaccgcatcggttacggcggcaaggccgcgccc
aacctcgaggtgctgcgggccctgatggccgcgcacaccggctcgatcccgttcgagaac
ctcgacccgctgatgggggtgccggtcgacgacctgagcccggcggcgctgaccgacaag
ctggtccaccggcgccgcggcggctactgctacgagcagaacggcctgctgggctacgcg
ctggccgaaatcggtttccgggtgcgccgattggccggccgggtggtgtggatgcagccg
cccgacacgccgccgcgcgcccagacgcacacggtcttggcggtgacgttcccgggctcg
cagggcgcctacctggtcgacgtcggcttcggtggccagacgttgccctcgcccatccgt
ttcgagaccggcaacgcccagcagaccacccacgagccgtaccggctcgatgaccgcggc
gagggcctggtgctgcaggccctggtgcgcgatgaatggccgccgctgtacgtgttcggc
acccgcaccgtgccgcagatcgacctgctggtgggcagctggtacgtctccacccacccg
tcgtcgatgttcgtcaccgggctgatggtcgcgcggaccaccgccgacgcccggtggaac
ctggccgggcgcgagctgaccgtgcaccgcgcgcagagcagcgagaagatccgcctcgac
gacgcggacgcggtgctcgacgtgctcggggagcggttcggcatcgacgtggccgggatc
ggccagcgcggcgcgctgctggcgcgcatcgagcaggtgctggacgcctga

DBGET integrated database retrieval system